DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and SLC25A42

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_016882159.1 Gene:SLC25A42 / 284439 HGNCID:28380 Length:382 Species:Homo sapiens


Alignment Length:329 Identity:89/329 - (27%)
Similarity:150/329 - (45%) Gaps:43/329 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SEATTTTTPVPRRKHSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPG 73
            :||..:::...:|.|  |:.|..:|:|.|:.|:.::...|||..||.||                
Human    80 AEAVLSSSVSSKRDH--RQVLSSLLSGALAGALAKTAVAPLDRTKIIFQ---------------- 126

  Fly    74 ALTSKYTSIGQAVKTI---YREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYLAD 135
             ::||..|..:|.:.:   |..||.|:.|:|::...|..:.|...||..:|:...:.  .||...
Human   127 -VSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRIL--GSYYGF 188

  Fly   136 HQHL----SNFLCGAAAGGAAVIISTPLDVIRTRLIAQDTSKGYRNATRAVSAIVRQEGPRGMYR 196
            ....    .....||.||..|..::.|||::|.|: |....:.|.|.......|.|:||.:.:|.
Human   189 RGEALPPWPRLFAGALAGTTAASLTYPLDLVRARM-AVTPKEMYSNIFHVFIRISREEGLKTLYH 252

  Fly   197 GLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLI 261
            |....:|.:.|..|.:|..|.....   ...|.|.|.|...:..:..||.:|::.::..||.|::
Human   253 GFMPTVLGVIPYAGLSFFTYETLKS---LHREYSGRRQPYPFERMIFGACAGLIGQSASYPLDVV 314

  Fly   262 KKRLQIQGFES-NRQTFGQTLQCHGVWDCLRLTVRQEG-VRGLYKGVAPTLLKSSMTTALYFSIY 324
            ::|:|..|... .|.:..:|         ||..||:|| |||||||::...:|..:...:.|:.:
Human   315 RRRMQTAGVTGYPRASIART---------LRTIVREEGAVRGLYKGLSMNWVKGPIAVGISFTTF 370

  Fly   325 DKLK 328
            |.::
Human   371 DLMQ 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 27/96 (28%)
PTZ00169 33..329 CDD:240302 83/305 (27%)
Mito_carr 153..222 CDD:278578 19/68 (28%)
Mito_carr 233..328 CDD:278578 28/96 (29%)
SLC25A42XP_016882159.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.