DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc1 and slc25a43

DIOPT Version :9

Sequence 1:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_002934585.2 Gene:slc25a43 / 100485727 XenbaseID:XB-GENE-6258507 Length:342 Species:Xenopus tropicalis


Alignment Length:312 Identity:84/312 - (26%)
Similarity:142/312 - (45%) Gaps:52/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLA 97
            |.||::...:|:...||||:||..|     :|....|:|          .....|.:.:.||:.|
 Frog    17 LCGGIAGVASRTLTAPLDVVKILSQ-----VGTFHTKQG----------FAGTFKLLCKAEGVRA 66

  Fly    98 FWKGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNF---LCGAAAGGAAVIISTPL 159
            .|||:..|.|....|...|...|.:.:|:     ::.|...:|.:   :.|..||..|.::..|.
 Frog    67 LWKGNLTACVRLFPYSAVQLAAYRRFTLL-----FMDDLGRISKWQAIVSGGLAGVVAAVVIYPT 126

  Fly   160 DVIRTRLIAQDT-SKGYRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWA 223
            |:::||||.|:: ...||....|:.:|..|||.|.:|||:|..:|...|...:.|          
 Frog   127 DIVKTRLIVQNSLEPTYRGIIHALCSIYYQEGFRSLYRGISLTVLGAIPFSASLF---------- 181

  Fly   224 CAFLEVS-DRSQLPTWTLLGL----------GASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTF 277
              |:.:| ||    .|...|:          |..:..:::|:.:||:.:|:::|.|. :......
 Frog   182 --FMNISLDR----IWQEPGVCLSPLQHFANGCLAAAVAQTMSFPFETVKRKMQAQS-QFLPHCG 239

  Fly   278 GQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLKQ 329
            |..:..:|:.:|.|..|:.:||..|:.|:...:||......|.||.|:..|:
 Frog   240 GVDVHFNGMLNCFRQIVKTKGVLSLWNGLTANILKVVPYFGLMFSTYECCKR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 26/89 (29%)
PTZ00169 33..329 CDD:240302 83/310 (27%)
Mito_carr 153..222 CDD:278578 22/69 (32%)
Mito_carr 233..328 CDD:278578 24/104 (23%)
slc25a43XP_002934585.2 PTZ00169 17..274 CDD:240302 77/293 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.