DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and MPD2

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_014553.1 Gene:MPD2 / 854065 SGDID:S000005448 Length:277 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:22/101 - (21%)
Similarity:38/101 - (37%) Gaps:27/101 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 VVLGATASLDSKPM-----NYFELREESSSDMLVMLYDPACYYW----PIQKRMLRKLIRLLASE 199
            |:|.|.|..::..|     .||::...:.|..::..|...|.:.    |:.:.:.....:....:
Yeast    16 VILPALAYSEAVTMVKSIEQYFDICNRNDSYTMIKYYTSWCQHCKTLAPVYEELGELYAKKANKD 80

  Fly   200 DLPIVIVDKANNYLGVGFTRWLQMVNCH--GSTIFT 233
            |.||       |:|         .|||.  |.|:.|
Yeast    81 DTPI-------NFL---------EVNCEFFGPTLCT 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560
MPD2NP_014553.1 Thioredoxin_like <48..170 CDD:412351 14/69 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.