DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and EUG1

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_010806.1 Gene:EUG1 / 852130 SGDID:S000002926 Length:517 Species:Saccharomyces cerevisiae


Alignment Length:296 Identity:55/296 - (18%)
Similarity:96/296 - (32%) Gaps:123/296 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NSIPWILW-----LPPLTEVDRKSPGGRFTFDGPKVV------AFHFVKNRHGDTLDKWISLLDE 65
            ||:....|     ||..|:::..      .|  ||.:      |:.|..:.  :.|:.:..|..:
Yeast   224 NSVALTQWLKVVILPYFTDIEPD------LF--PKYISSNLPLAYFFYTSE--EELEDYTDLFTQ 278

  Fly    66 LAQEYAGRI------------------------LFGLRD-ISNIGEFNPNLNPDDFG-------- 97
            |.:|..|:|                        ||.:.: |:|:....|.|..:::.        
Yeast   279 LGKENRGQINFIALNSTMFPHHVRFLNMREQFPLFAIHNMINNLKYGLPQLPEEEYAKLEKPQPL 343

  Fly    98 ----------SYRKG----------LPP-------RIYGKDCEGRVYDMHKLVNAKYLREFC--- 132
                      .||:|          :|.       :|.||..:..|:|..|.|..||...:|   
Yeast   344 DRDMIVQLVKDYREGTAKPIVKSEEIPKEQKSNVYKIVGKTHDDIVHDDDKDVLVKYYATWCIHS 408

  Fly   133 -----------DQLLADQLFRAVVLGATASLDSKPMNYFELREESSSDML---------VMLYDP 177
                       :.|.:|:..|..:|  .|.:||           .::|:|         :.||..
Yeast   409 KRFAPIYEEIANVLASDESVRDKIL--IAEVDS-----------GANDILSFPVTGYPTIALYPA 460

  Fly   178 ACYYWPIQKRMLRKLIRLLASEDLPIVIVDKANNYL 213
            .....||....:|.|      ||:...|.:...:::
Yeast   461 GNNSKPIIFNKIRNL------EDVFEFIKESGTHHI 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 34/193 (18%)
EUG1NP_010806.1 ER_PDI_fam 33..487 CDD:273457 55/291 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.