DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and Txndc16

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001297463.1 Gene:Txndc16 / 70561 MGIID:1917811 Length:820 Species:Mus musculus


Alignment Length:236 Identity:42/236 - (17%)
Similarity:85/236 - (36%) Gaps:58/236 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDF----GSYRKGLPPRIYGKDCEGRVYDMHKL 122
            |..|..::..|.::.|:            .:.||.    ..|...||..:..:..|||:..:.  
Mouse   544 LFREAGKQLRGSVITGI------------YSEDDVWILSNKYATTLPALLLARPKEGRIESVP-- 594

  Fly   123 VNAKYLREFCDQLLADQLFRAVVLGATASLDSKPMNYFELREESSSDMLVMLYDPACYYWPIQKR 187
            ::...:::.. |:||:.|..|.   ...::::.| .|...:..     |::|:...... |..:.
Mouse   595 LDTTLVQDMA-QILANALLEAF---PEITVENLP-TYLRFQRP-----LLLLFSGGSIN-PQYRN 648

  Fly   188 MLRKLIRLLASEDLPIVIVDKANNYLGVGFTR----------WLQMVNCH-GSTIFTSPRRDGWD 241
            .:..|:|....:......::..|..:|.|..:          .|.:||.| |..::..|...   
Mouse   649 TILALVRQKQLDSFTPCWLNLKNTPVGRGILKAYFGRLPPLPQLLLVNLHSGGQVYAFPSSQ--- 710

  Fly   242 IKLSVRMESTRGYLRYI------------ARNRQPELIDFD 270
               ||..:|...:|:::            |:..:|.|..||
Mouse   711 ---SVTEQSLVLWLKHLQAGLENPITVLSAQEWKPPLPAFD 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 12/75 (16%)
Txndc16NP_001297463.1 ER_PDI_fam 65..493 CDD:273457
PDI_a_family 395..493 CDD:239259
Thioredoxin_6 534..722 CDD:372755 36/208 (17%)
Mediates endoplasmic reticulum retention. /evidence=ECO:0000250|UniProtKB:Q9P2K2 817..820
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.