DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and Pdia2

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001074539.1 Gene:Pdia2 / 69191 MGIID:1916441 Length:527 Species:Mus musculus


Alignment Length:206 Identity:41/206 - (19%)
Similarity:75/206 - (36%) Gaps:52/206 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PKVVAFHFVKNRH-----GDTLDKWISLLD---ELAQEYAGRILFGLRDI----SNI-------G 85
            ||:.|...:  .|     ..||.:...||.   |.|..:.|::||.:.|:    |::       .
Mouse   271 PKIFAAKIL--NHLLLFVNQTLAQHRELLTDFREAAPPFRGQVLFVMVDVAADNSHVLNYFGLKA 333

  Fly    86 EFNPNLNPDDFGSYRKGLPPRIYGKDCEGRVYDMHKLVNAKYLREFCDQLLADQLFRAVV----- 145
            |..|.|...:..:.:|..|..:..             :.|..:..||..:|..::...::     
Mouse   334 EEAPTLRLINVETTKKYAPTGVIA-------------ITAASVAAFCQAVLHGEIKHYLLSQEIP 385

  Fly   146 ----LGATASLDSKPMNYFELREESSSDMLVMLYDPACYYW----PIQKRMLRKLIRLLASEDLP 202
                .|...:|.||  |:.::..:.:.::.|..|.|.|.:.    |..:.:..|   ....||:.
Mouse   386 PDWDQGPVKTLVSK--NFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEK---YKDREDIV 445

  Fly   203 IVIVDKANNYL 213
            |..:|...|.|
Mouse   446 IAELDATANEL 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 23/112 (21%)
Pdia2NP_001074539.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..41
ER_PDI_fam 45..506 CDD:273457 41/206 (20%)
PDI_a_family 48..150 CDD:239259
PDI_b_family 158..257 CDD:239279
PDI_b'_family 262..371 CDD:239280 23/114 (20%)
PDI_a_PDI_a'_C 392..494 CDD:239293 16/70 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..527
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 524..527
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.