Sequence 1: | NP_650032.1 | Gene: | CG14695 / 41314 | FlyBaseID: | FBgn0037850 | Length: | 289 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081259.1 | Gene: | Erp27 / 69187 | MGIID: | 1916437 | Length: | 272 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 42/195 - (21%) |
---|---|---|---|
Similarity: | 68/195 - (34%) | Gaps: | 77/195 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 DGPKVVAFHFVKNRHGDTLDKWISLLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYRKG 102
Fly 103 LPPRIYGKDCEGRVYDMHKLVNAKY---LREFCDQLLADQLFRAVVLGATASLDS------KPMN 158
Fly 159 YFELREESSSDMLVMLYDPACYYWPIQKRMLRKLIRLLASEDLPI--VIVDKANNYLGVGFTRWL 221
Fly 222 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14695 | NP_650032.1 | Thioredoxin_6 | <20..134 | CDD:290560 | 18/98 (18%) |
Erp27 | NP_081259.1 | Thioredoxin_6 | 64..250 | CDD:372755 | 39/187 (21%) |
PDIA3-binding site. /evidence=ECO:0000250|UniProtKB:Q96DN0 | 230..233 | 1/18 (6%) | |||
Prevents secretion from ER. /evidence=ECO:0000250|UniProtKB:Q96DN0 | 269..272 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0191 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |