DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and Erp27

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_081259.1 Gene:Erp27 / 69187 MGIID:1916437 Length:272 Species:Mus musculus


Alignment Length:195 Identity:42/195 - (21%)
Similarity:68/195 - (34%) Gaps:77/195 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DGPKVVAFHFVKNRHGDTLDKWISLLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYRKG 102
            |..|:..|..|.|.|      |::       ||:..|..||        ||..:           
Mouse   128 DAAKLSRFIHVNNLH------WVT-------EYSPMIAAGL--------FNTMV----------- 160

  Fly   103 LPPRIYGKDCEGRVYDMHKLVNAKY---LREFCDQLLADQLFRAVVLGATASLDS------KPMN 158
                      :..:..|.|..:.:|   :|.:.:   |.:||:..:|  ...:||      |.|:
Mouse   161 ----------QTHLLLMMKKTSPEYEESMRRYRE---AAKLFQGQIL--FVLVDSGKRENGKVMS 210

  Fly   159 YFELREESSSDMLVMLYDPACYYWPIQKRMLRKLIRLLASEDLPI--VIVDKANNYLGVGFTRWL 221
            ||:|:|  |....:.:|:.....|                :.|||  |.|:|...:. .||.:.|
Mouse   211 YFKLKE--SQLPALAIYESVDDKW----------------DTLPIAEVTVEKVRGFC-EGFLKGL 256

  Fly   222  221
            Mouse   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 18/98 (18%)
Erp27NP_081259.1 Thioredoxin_6 64..250 CDD:372755 39/187 (21%)
PDIA3-binding site. /evidence=ECO:0000250|UniProtKB:Q96DN0 230..233 1/18 (6%)
Prevents secretion from ER. /evidence=ECO:0000250|UniProtKB:Q96DN0 269..272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.