Sequence 1: | NP_650032.1 | Gene: | CG14695 / 41314 | FlyBaseID: | FBgn0037850 | Length: | 289 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035331.1 | Gene: | zgc:136472 / 678514 | ZFINID: | ZDB-GENE-060421-2552 | Length: | 510 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 39/195 - (20%) |
---|---|---|---|
Similarity: | 80/195 - (41%) | Gaps: | 45/195 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 FVKNRHGDTLDKWISLLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYRKGLPPRIYGKD 111
Fly 112 CEGRV--------YDMHKLVNAKYLREFC----DQLLADQLFRAVVLGATASLDSKP------MN 158
Fly 159 YFELREESSSDMLVMLYDPACYYWPIQKRMLRKLIRLLA-----SEDLPIVIVDKANN----YLG 214
Fly 215 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14695 | NP_650032.1 | Thioredoxin_6 | <20..134 | CDD:290560 | 18/98 (18%) |
zgc:136472 | NP_001035331.1 | ER_PDI_fam | 31..478 | CDD:273457 | 39/195 (20%) |
PDI_a_family | 34..122 | CDD:239259 | |||
PDI_b_family | 147..240 | CDD:239279 | |||
PDI_b'_family | 252..354 | CDD:239280 | 18/96 (19%) | ||
PDI_a_PDI_a'_C | 375..477 | CDD:239293 | 17/74 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000292 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |