DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and zgc:136472

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001035331.1 Gene:zgc:136472 / 678514 ZFINID:ZDB-GENE-060421-2552 Length:510 Species:Danio rerio


Alignment Length:195 Identity:39/195 - (20%)
Similarity:80/195 - (41%) Gaps:45/195 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FVKNRHGDTLDKWISLLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYRKGLPPRIYGKD 111
            |:....|. .::..:..:..|:.:.|::||.|.|:|.:    .|....::...|....|::...:
Zfish   268 FISKTEGG-FEEIYNAYETTAERFRGKVLFVLIDVSEL----RNGRMMEYFHVRSEEAPQVRMVN 327

  Fly   112 CEGRV--------YDMHKLVNAKYLREFC----DQLLADQLFRAVVLGATASLDSKP------MN 158
            ....:        :|.|.|:      |||    |..:..::....|   .|:.|::|      ||
Zfish   328 LSNNLQYQLPSDQFDTHTLM------EFCLNYLDGKVKPKMQSEPV---PANWDTQPVKELVGMN 383

  Fly   159 YFELREESSSDMLVMLYDPACYYWPIQKRMLRKLIRLLA-----SEDLPIVIVDKANN----YLG 214
            :.::....:::::|:.|.|    |..:.|.|..|...||     ::|:.:..:|...|    :||
Zfish   384 FEKVAFNHNNNVIVLFYAP----WNSECRALFPLWEELADHFSQTQDVVVAKIDITANDIHLHLG 444

  Fly   215  214
            Zfish   445  444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 18/98 (18%)
zgc:136472NP_001035331.1 ER_PDI_fam 31..478 CDD:273457 39/195 (20%)
PDI_a_family 34..122 CDD:239259
PDI_b_family 147..240 CDD:239279
PDI_b'_family 252..354 CDD:239280 18/96 (19%)
PDI_a_PDI_a'_C 375..477 CDD:239293 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.