Sequence 1: | NP_650032.1 | Gene: | CG14695 / 41314 | FlyBaseID: | FBgn0037850 | Length: | 289 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_077143.2 | Gene: | Dnajc10 / 66861 | MGIID: | 1914111 | Length: | 793 | Species: | Mus musculus |
Alignment Length: | 215 | Identity: | 45/215 - (20%) |
---|---|---|---|
Similarity: | 67/215 - (31%) | Gaps: | 81/215 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 FTFDGPKVVAFH-----------FVK---NRHGDTL--------DK--WI------------SLL 63
Fly 64 DELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYRKGLPPRIYGKDC---EG-------RVYD 118
Fly 119 MHKLVNAKYLREFCDQLLADQLFRAVV-LGATASLDSKPMNYFELREESSSD--MLVMLYDPACY 180
Fly 181 ----YWPIQKRMLRKLIRLL 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14695 | NP_650032.1 | Thioredoxin_6 | <20..134 | CDD:290560 | 27/144 (19%) |
Dnajc10 | NP_077143.2 | DnaJ | 34..>132 | CDD:223560 | |
DnaJ | 35..97 | CDD:278647 | |||
PDI_a_ERdj5_N | 129..229 | CDD:239301 | |||
ER_PDI_fam | 130..551 | CDD:273457 | 29/155 (19%) | ||
Trxb 1 | 235..350 | ||||
Trxb 2 | 348..463 | 10/39 (26%) | |||
PDI_a_ERdj5_C | 453..550 | CDD:239302 | 22/124 (18%) | ||
PDI_a_ERdj5_C | 556..663 | CDD:239302 | 15/54 (28%) | ||
PDI_a_ERdj5_C | 670..775 | CDD:239302 | |||
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 | 790..793 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0191 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |