DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and qsox2

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:XP_009300239.1 Gene:qsox2 / 559603 ZFINID:ZDB-GENE-110203-4 Length:656 Species:Danio rerio


Alignment Length:299 Identity:56/299 - (18%)
Similarity:92/299 - (30%) Gaps:140/299 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LLDELAQEYAGRILFGLRDISNIGEFNPN-----LNPDD-----FGSYRKGLP------------ 104
            |:|:|          |:..:.:...|.||     ||...     |.|:.|.||            
Zfish   217 LMDKL----------GISSVPSAYLFQPNGTHTVLNVQKKLRFFFSSFLKLLPGVHRKQSTSSLQ 271

  Fly   105 --------------------PRIYGKDCEGRVYDM-------HKLVNAKYLREFCDQL-LADQLF 141
                                .::|..|.|..::.:       ||.:..:.|:.|.|.: :..:||
Zfish   272 RPQPGINGQGAQVEWKEFKKSKVYMADLESGLHYLLRVELATHKTLEGEELKTFKDFVTVVAKLF 336

  Fly   142 ---RAVVLGATASLDSKPMNYFELREESSSDMLVMLYDPACYYWPIQKRMLRKLIRLLAS---ED 200
               ::||                                         ::|..|:..|.|   |.
Zfish   337 PGHQSVV-----------------------------------------KLLETLLEWLVSLPLEK 360

  Fly   201 LPI-VIVDKANNYL---GVGFTRWLQMVNCHGSTIFTSPRRDGWDIKLSVRMESTRGY------- 254
            :|. .|:|..||.:   |:..:..:|.|.|.||::                  :.|||       
Zfish   361 IPYDAILDLVNNKMRISGLYLSEQVQWVGCQGSSV------------------ALRGYPCSLWTL 407

  Fly   255 ---LRYIARNRQPELIDFDADGEPRALEQAV-EYIQYLF 289
               |...|.||...|.:...:.:|.|:.|.: .||...|
Zfish   408 FHVLTVQAANRPDALANTGFEDDPLAVLQTMRRYIGTFF 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 21/120 (18%)
qsox2XP_009300239.1 PDI_a_QSOX 30..141 CDD:239290
Evr1_Alr 403..499 CDD:282612 11/44 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.