DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and txndc16

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:XP_685017.4 Gene:txndc16 / 556973 ZFINID:ZDB-GENE-100712-1 Length:804 Species:Danio rerio


Alignment Length:274 Identity:50/274 - (18%)
Similarity:100/274 - (36%) Gaps:83/274 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILWLPPLTEVDRKSPGGRFTFDGPKVVAFHFVKNRHGDTLDKWISLLDELAQEYAGRILFGLRDI 81
            :|.|.|:||:...:.......:...||.|:|          ||.::.....|.|. .:...:.|:
Zfish   382 MLDLEPVTELTADTFQTAIKQNEITVVLFYF----------KWDAVCMAFIQSYV-EVAEAVEDV 435

  Fly    82 SNIGEFNPNLNPDDFGSYRKGLPPRIYGKDCEGRVYDM---HKLVNAKYLREFCDQLLADQLFRA 143
            :.:                     .:...|| |...|:   ..:.:...:..:|.:..|.|.:|.
Zfish   436 NGV---------------------ELAAVDC-GEWTDICRDQNITSFPTVLIYCPKAAAAQPYRG 478

  Fly   144 VVLGATA-------SLDSKPMNYFELREESSSDMLVM----LYDPACYYWPIQKRMLRKLIRLLA 197
             ::|..:       ||.|.|::.     .||::::..    ||....|..|:      :::.|.:
Zfish   479 -MMGTKSLQRFILLSLVSTPVHL-----SSSAEVMSFLEGDLYRKYVYLTPV------RVLGLFS 531

  Fly   198 S-EDLPIVIVDKANNYLG----VGF------TRWLQ--------MVNCHGST----IFTSPRRDG 239
            | :|:.:...::|...|.    :|.      .:|::        ::..||..    :|:.|....
Zfish   532 SMQDMGVSSFEEAARLLRGETIIGLFAHKEAAKWVEGLSVNLPALLVSHGPALPHQVFSLPSSLA 596

  Fly   240 WD-IKLSVRMESTR 252
            .| :||..|:|..|
Zfish   597 TDHVKLIQRVELER 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 18/116 (16%)
txndc16XP_685017.4 PDI_a_family 389..489 CDD:239259 20/133 (15%)
Thioredoxin_6 530..722 CDD:290560 16/81 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.