DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and pdia4

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_956073.2 Gene:pdia4 / 554998 ZFINID:ZDB-GENE-030131-5493 Length:642 Species:Danio rerio


Alignment Length:296 Identity:66/296 - (22%)
Similarity:112/296 - (37%) Gaps:83/296 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PLTEVDRKSPGGRFTFDGP--KVVAFHFVKNRHGDTLDKWISLLDELAQEYAGRILFGLRDISN- 83
            |..::.||  |..|.::||  |.....::.::.|.. .|.:..|.:: ||.       |||..: 
Zfish   250 PTLKIFRK--GKAFDYNGPREKFGIVDYMSDQAGPP-SKQVQTLKQV-QEL-------LRDGDDA 303

  Fly    84 --IGEFNPNLNPDDFGSYRKGLPPRIYGKDCEGRVYD---MHKLVN--AKYLREFCDQ--LLADQ 139
              :|.|    :.|:..:|      .||.:.|.....|   ||...|  .|:|:....|  :|..:
Zfish   304 VIVGVF----SSDEDAAY------EIYQEACNSLREDYKFMHTFNNDVTKFLKASPGQVVMLQPE 358

  Fly   140 LFRAVVLGATASL---DSKP----MNYFEL-------REESSSDM-------LVML--------- 174
            .||:....|:.||   ||.|    .::|:.       ..:.|:|.       ||::         
Zfish   359 KFRSKYESASHSLTIKDSTPASEVQDFFKKHILPLVGHRKQSNDAKRYTKRPLVVVYYGVDFSFD 423

  Fly   175 YDPACYYWPIQKRMLRKLIRLLASEDLP---IVIVDK---ANNYLGVGFTRWLQMVNC-----HG 228
            |..|..:|  :.::|.      .::|.|   ..|.|:   |:....:|.:...:.||.     .|
Zfish   424 YRVATQFW--RSKVLE------VAKDFPEYTFAIADEEDYADELKSLGLSESGEEVNVGIVGEGG 480

  Fly   229 STIFTSPRRDGWDIKLSVRMESTRGYLRYIARNRQP 264
            ......|.....|:..|..|...:|.|:.|.:: ||
Zfish   481 KKYAMEPEEFDSDVLRSFVMAFKKGKLKPIVKS-QP 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 29/121 (24%)
pdia4NP_956073.2 pdi_dom 64..165 CDD:273454
ER_PDI_fam 174..640 CDD:273457 66/296 (22%)
pdi_dom 179..280 CDD:273454 8/31 (26%)
PDI_b_ERp72 283..389 CDD:239366 31/124 (25%)
PDI_b'_ERp72_ERp57 394..503 CDD:239371 21/116 (18%)
PDI_a_PDI_a'_C 523..628 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.