DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and DNAJC10

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_061854.1 Gene:DNAJC10 / 54431 HGNCID:24637 Length:793 Species:Homo sapiens


Alignment Length:201 Identity:40/201 - (19%)
Similarity:63/201 - (31%) Gaps:72/201 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNSIPWIL-----WLPP----LTEVDRKSP--GGRFTFDGPKVVAFHFVKNRHGDTLDKWISLLD 64
            |:..||::     |.||    |.|:.|.|.  .|:..|..........:.|.:.           
Human   466 NDKEPWLVDFFAPWCPPCRALLPELRRASNLLYGQLKFGTLDCTVHEGLCNMYN----------- 519

  Fly    65 ELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYRKGLPPRIYGKDCEGRVYDMHKLVNAKYLR 129
              .|.|...::|   :.|||.|                              |:.|.  :|:.:.
Human   520 --IQAYPTTVVF---NQSNIHE------------------------------YEGHH--SAEQIL 547

  Fly   130 EFCDQLLADQLFRAVVLGATASLDSKPMNYFELREESSSDMLVMLYDPACY----YWPIQKRMLR 190
            ||.:.|:..         :..||.....|....:.:.:...:|..|.|.|:    ..|..|||.|
Human   548 EFIEDLMNP---------SVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMAR 603

  Fly   191 KLIRLL 196
            .|..|:
Human   604 TLTGLI 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 21/119 (18%)
DNAJC10NP_061854.1 DnaJ 34..>132 CDD:223560
PDI_a_ERdj5_N 129..229 CDD:239301
Trxb 1 235..350
Trxb 2 348..463
PDI_a_ERdj5_C 453..550 CDD:239302 24/131 (18%)
PDI_a_ERdj5_C 556..663 CDD:239302 14/63 (22%)
PDI_a_ERdj5_C 670..775 CDD:239302
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 790..793
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.