Sequence 1: | NP_650032.1 | Gene: | CG14695 / 41314 | FlyBaseID: | FBgn0037850 | Length: | 289 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061854.1 | Gene: | DNAJC10 / 54431 | HGNCID: | 24637 | Length: | 793 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 40/201 - (19%) |
---|---|---|---|
Similarity: | 63/201 - (31%) | Gaps: | 72/201 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 NNSIPWIL-----WLPP----LTEVDRKSP--GGRFTFDGPKVVAFHFVKNRHGDTLDKWISLLD 64
Fly 65 ELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYRKGLPPRIYGKDCEGRVYDMHKLVNAKYLR 129
Fly 130 EFCDQLLADQLFRAVVLGATASLDSKPMNYFELREESSSDMLVMLYDPACY----YWPIQKRMLR 190
Fly 191 KLIRLL 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14695 | NP_650032.1 | Thioredoxin_6 | <20..134 | CDD:290560 | 21/119 (18%) |
DNAJC10 | NP_061854.1 | DnaJ | 34..>132 | CDD:223560 | |
PDI_a_ERdj5_N | 129..229 | CDD:239301 | |||
Trxb 1 | 235..350 | ||||
Trxb 2 | 348..463 | ||||
PDI_a_ERdj5_C | 453..550 | CDD:239302 | 24/131 (18%) | ||
PDI_a_ERdj5_C | 556..663 | CDD:239302 | 14/63 (22%) | ||
PDI_a_ERdj5_C | 670..775 | CDD:239302 | |||
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 | 790..793 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0191 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |