DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and l(2)01289

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001163065.1 Gene:l(2)01289 / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster


Alignment Length:263 Identity:53/263 - (20%)
Similarity:89/263 - (33%) Gaps:107/263 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DNNSIPWILWLPPLTEVDRKSPGGRFTFDG-PKVVAFH-FVKNRH-GDTLD-----KWI------ 60
            |.:.|.::       ::|.......:..|. |.:|.|. .:.|.: ||.:|     ||:      
  Fly   323 DKHGIQFV-------KIDDAKAAADYGIDSIPAIVYFEKEIPNVYDGDLMDEEQILKWLLGQLER 380

  Fly    61 --------SLLDELAQEYAGR---ILF----------GLRDISNIGE--------FNPNLNPDDF 96
                    .:||.:.:|  ||   :||          .|.::.||.:        |....||::.
  Fly   381 DEIEDVTDEMLDTMIKE--GRVIAVLFYDNNDKKSQKVLEELENIDDECDALGITFVKIDNPEEA 443

  Fly    97 GSY-----------RKGLPPRIYGKDCEGRVYDMHKLVNAKYLREFCDQLLADQLFRAVVLGATA 150
            ..|           .||: |.||    ||.:.|..||     |:...||..:||:          
  Fly   444 VEYGINKVPKLIYFEKGI-PTIY----EGNLEDEEKL-----LKWLTDQTSSDQI---------- 488

  Fly   151 SLDSKPMNYFELREESSSDMLVMLYD-----PACYYWPIQKRMLRKLIRL------LASEDLPIV 204
                         |:.:.:||.::.:     ...:|...||:..:.|..|      ....|:..|
  Fly   489 -------------EDITDEMLDLIIEKMPHVAVLFYDKDQKKSQKILAELENIDDECDQNDIAFV 540

  Fly   205 IVD 207
            .:|
  Fly   541 KID 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 36/167 (22%)
l(2)01289NP_001163065.1 PDI_a_family 50..145 CDD:239259
PDI_a_family 384..479 CDD:239259 25/106 (24%)
Thioredoxin_6 510..689 CDD:404691 8/34 (24%)
ER_PDI_fam 700..>916 CDD:273457
PDI_a_family 1129..1226 CDD:239259
TRX_family 1433..>1502 CDD:239245
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.