DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and pdia8

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001003517.1 Gene:pdia8 / 445123 ZFINID:ZDB-GENE-040801-20 Length:493 Species:Danio rerio


Alignment Length:266 Identity:50/266 - (18%)
Similarity:101/266 - (37%) Gaps:78/266 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FVKNRHGDTLDKWISLLDELAQEYAGR-ILFGLRDISNIGEFNPNLNPDDFG-SYRKGLP-PRIY 108
            ::.|..|.  :.|.:.:.::|.:::.: :||   .::|..:|...|. ::|| |...|.. |.:.
Zfish   265 YLHNPKGS--NYWRNRVLKVATKFSSQGMLF---SVANRNDFMEELE-EEFGLSASDGNELPFVT 323

  Fly   109 GKDCEGRVYDMHK--LVNAKYLREFCDQLLADQLFRAVVLGATASLDSKPM-------------- 157
            .:...|..|.|.:  ..:.|.|..|.:...|.:|.|.|        .|:|:              
Zfish   324 IRTRTGDKYSMREEFTRDGKSLESFLEDYFAGRLKRYV--------KSEPVPAINNGVVKVVVAD 380

  Fly   158 NYFELREESSSDMLVMLYDPACYYWPIQKRMLRKLIRLLASEDLPIVIVDKANNYLGVGFTRWLQ 222
            .:.|:..:...|:|:..|.|.|.:....:.....|..:|.|:  |.:::.|.:            
Zfish   381 TFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTALGEMLYSD--PNIVIAKMD------------ 431

  Fly   223 MVNCHGSTIFTSPRRDGWDIKLSVRMESTRGY--LRYIARNRQPELIDFDADGEPRALEQAVE-- 283
                  :|:...|.  |:|:         :|:  :.:.|..|:         .||:..|.|.|  
Zfish   432 ------ATVNDVPA--GYDV---------QGFPTIYFAAAGRK---------SEPKRYEGAREVK 470

  Fly   284 -YIQYL 288
             ::.:|
Zfish   471 DFVNFL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 20/91 (22%)
pdia8NP_001003517.1 ER_PDI_fam 25..484 CDD:273457 50/266 (19%)
pdi_dom 30..129 CDD:273454
PDI_b_ERp57 132..236 CDD:239367
PDI_b'_ERp72_ERp57 240..353 CDD:239371 20/93 (22%)
PDI_a_PDI_a'_C 373..476 CDD:239293 23/142 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.