DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and CG11790

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster


Alignment Length:73 Identity:18/73 - (24%)
Similarity:33/73 - (45%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 AVVLGATASLDSKPMNYFELRE--ESSSDMLVMLYDPACYYWPIQKRMLRKLIRLLASEDLPIVI 205
            |:.||.....|.:.::..||.:  ..||:::|:.....|......:.|:.| ||....|.|..::
  Fly    11 ALSLGCAVGQDLRRVDDTELIQLLTGSSNVVVLFNKNNCQRCVEYENMVTK-IRAQLEETLSAIV 74

  Fly   206 VDKANNYL 213
            |...::.|
  Fly    75 VQSVDSNL 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.