DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and pdia7

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_998070.1 Gene:pdia7 / 405841 ZFINID:ZDB-GENE-040426-2238 Length:488 Species:Danio rerio


Alignment Length:258 Identity:57/258 - (22%)
Similarity:97/258 - (37%) Gaps:63/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FVKNRHGDTLDKWISLLDELAQEYAGR-ILFGLRDISNIGEFNPNLNPDDFG--SYRKGLPPRIY 108
            :::|..|  .:.|.:.:.::|.::..| :.|.:.|..   ||...|. ::||  |...|..|.:.
Zfish   260 YLRNPKG--TNYWRNRIMKVATQFQDRGLTFAVADRQ---EFQDELE-EEFGVSSSEGGDVPLVT 318

  Fly   109 GKDCEGRVYDMHK--LVNAKYLREFCDQLLADQLFRAVVLGATASLDSKPM------NYFELREE 165
            .:...|:.|.|.:  ..:.|.|.:|.:...|.:|.|.|........:..|:      .:..:..:
Zfish   319 IRTRAGQKYSMQEEFTRDGKSLEKFLEDYFAKRLKRYVKSEPIPESNDGPVKVLVADTFDAIVND 383

  Fly   166 SSSDMLVMLYDPACYYW----PIQKRMLRKLIRLLASEDLPIVIVDK----AN----NYLGVGFT 218
            ...|:||..|.|.|.:.    |..|.:..||      ...|.:::.|    ||    ||...|| 
Zfish   384 PEKDVLVEFYAPWCGHCKNLEPKYKELGEKL------SGNPNIVIAKMDATANDVPPNYDVQGF- 441

  Fly   219 RWLQMVNCHGSTIF-------TSPRR--DGWDIKLSVRMESTRGYLRYIARNRQPELIDFDAD 272
                      .||:       ..|||  .|.::...:.      ||:..|.|  |.::|...|
Zfish   442 ----------PTIYFVPSGQKDQPRRYEGGREVNDFIT------YLKKEATN--PLILDDSRD 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 21/91 (23%)
pdia7NP_998070.1 ER_PDI_fam 20..483 CDD:273457 55/253 (22%)
Thioredoxin_like 25..124 CDD:294274
PDI_b_ERp57 127..231 CDD:239367
PDI_b'_ERp72_ERp57 235..348 CDD:239371 21/93 (23%)
PDI_a_PDI_a'_C 368..471 CDD:239293 25/125 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.