DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and ERp60

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster


Alignment Length:257 Identity:65/257 - (25%)
Similarity:113/257 - (43%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FDGPKVVAFHFV---KNRHGDTLDKWISLLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGS 98
            |..|.:.|::.|   ||..|  .:.|.:.:.::|:|:.|:|.|.   |::..:|...||  ::|.
  Fly   250 FQNPLITAYYSVDYQKNPKG--TNYWRNRVLKVAKEFVGQINFA---IASKDDFQHELN--EYGY 307

  Fly    99 YRKGLPPRIYGKDCEGRVYDMHKLVNAKYLREFCDQLLADQLFRAVVLGATASLDSKPM------ 157
            ...|..|.:..:|.:...|.:....:.:.|::|.::|||::|...:........:..|:      
  Fly   308 DFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPESNDAPVKVAVAK 372

  Fly   158 NYFELREESSSDMLVMLYDPACYYWPIQKRMLRKLIRLLASEDLPIVIVDKANNYLGVGFTRWLQ 222
            |:.:|...:..|.|:..|.|.|.:......:..:|...|..||:.||.:|...|.:...|     
  Fly   373 NFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIVKMDATANDVPPEF----- 432

  Fly   223 MVNCHG-STIFTSPRRDGWDIK-LSVRMESTR---GYLRYIARNRQPELIDFDADGEPRALE 279
              |..| .|:|..|:    |.| ..|.....|   .:|:|||:....||..||..|:|:..|
  Fly   433 --NVRGFPTLFWLPK----DAKNKPVSYNGGREVDDFLKYIAKEATTELKGFDRSGKPKKTE 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 24/99 (24%)
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 60/246 (24%)
PDI_a_PDIR 23..126 CDD:239295
PDI_b_ERp57 133..235 CDD:239367
PDI_b'_ERp72_ERp57 239..345 CDD:239371 24/101 (24%)
PDI_a_PDI_a'_C 365..467 CDD:239293 27/112 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.