DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and Pdia5

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001014147.1 Gene:Pdia5 / 360722 RGDID:1359236 Length:517 Species:Rattus norvegicus


Alignment Length:150 Identity:32/150 - (21%)
Similarity:57/150 - (38%) Gaps:32/150 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KVVAFHFVKNRHGDTLDKWISLLDELA--QEYAGRILF----GLRDISNIG---EFNPNLNPDDF 96
            |:..||:.........|:.::|...:|  ::..|..|:    |.:|:.:|.   :|...|..:: 
  Rat   105 KIELFHYQDGAFHMQYDRAVTLKSIVAFLKDPKGPPLWEEDPGAKDVVHIDSEKDFRRLLKKEE- 168

  Fly    97 GSYRKGLPPRIYGKDCEGRVYDMHKLVNAKYLREFCDQLLADQLFRAVVLGATASLDSKPMNYFE 161
                |.|....|...|     .|.|.:...:      |..|.|:....||   |.::..|..:..
  Rat   169 ----KPLLMMFYAPWC-----SMCKRIMPHF------QKAATQVRGHTVL---AGMNVYPPEFEN 215

  Fly   162 LREESSSDMLVMLYDPACYY 181
            ::||.:    |..|...||:
  Rat   216 IKEEYN----VRGYPTICYF 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 19/101 (19%)
Pdia5NP_001014147.1 PDI_b_PDIR_N 26..137 CDD:239365 6/31 (19%)
PDI_a_PDIR 150..254 CDD:239295 23/104 (22%)
ER_PDI_fam 166..501 CDD:273457 19/88 (22%)
PDI_a_PDIR 275..377 CDD:239295
PDI_a_PDIR 396..499 CDD:239295
Prevents secretion from ER. /evidence=ECO:0000255 514..517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.