powered by:
Protein Alignment CG14695 and CG18132
DIOPT Version :9
Sequence 1: | NP_650032.1 |
Gene: | CG14695 / 41314 |
FlyBaseID: | FBgn0037850 |
Length: | 289 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_608603.1 |
Gene: | CG18132 / 33333 |
FlyBaseID: | FBgn0031345 |
Length: | 192 |
Species: | Drosophila melanogaster |
Alignment Length: | 43 |
Identity: | 12/43 - (27%) |
Similarity: | 17/43 - (39%) |
Gaps: | 8/43 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 ADQLFRAVVLGATASLDSKPMNYFELREESSSDMLVMLYDPAC 179
|||.....:|..... |:||..|:.: ..|..|:|.|
Fly 44 ADQCTPGTILKLRVD------NFFETTEDGT--FFVKFYEPNC 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0191 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.