DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and pdia6

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_922915.2 Gene:pdia6 / 322160 ZFINID:ZDB-GENE-030131-879 Length:440 Species:Danio rerio


Alignment Length:96 Identity:17/96 - (17%)
Similarity:38/96 - (39%) Gaps:22/96 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KWISLLDELAQEYAGRI---------------LFGLRDISNIGEFNPNLNPDDF--GSYRKGLPP 105
            :|.:...|:.::..|::               .||:|....|..|.....|:|:  |..|..:..
Zfish   199 EWTAAATEVKEQTKGKVRLAAEDATVHQGLASRFGIRGFPTIKVFRKGEEPEDYQGGRTRSDIVA 263

  Fly   106 R---IYGKDCEGRVYDMHKLVNAKYLREFCD 133
            |   :|..:....  ::.:::|...|::.|:
Zfish   264 RALELYSDNIPAP--ELQEVLNEGILKKTCE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 17/96 (18%)
pdia6NP_922915.2 ER_PDI_fam 25..262 CDD:273457 12/62 (19%)
PDI_a_P5 26..128 CDD:239299
PDI_a_P5 161..266 CDD:239299 13/66 (20%)
P5_C 275..404 CDD:239281 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.