DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and Erp27

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001100095.1 Gene:Erp27 / 297698 RGDID:1565381 Length:272 Species:Rattus norvegicus


Alignment Length:219 Identity:50/219 - (22%)
Similarity:85/219 - (38%) Gaps:39/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ISLLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYRKGLPPRIYGKDCEGRVYDMHKLVN 124
            :|:...:||::.. :.||   |||..|...:.|...             ...|      :.:||:
  Rat    72 VSIFRSMAQQFQD-VSFG---ISNHSEVLTHYNVTS-------------NSIC------LFRLVD 113

  Fly   125 AKYLR---EFCDQLLADQLFRAVVLGATASL-DSKPMNYFELREESSSDMLVMLYDPACYYWPIQ 185
            .|.||   |..|.|.|.:|.|.:.|.....: :..||....|........|:::.:.|...:...
  Rat   114 NKQLRLDAEDIDDLDAAKLSRFIHLNNLHWVTEYSPMIGAGLFNTMVQTHLLLIMNKASPEYEES 178

  Fly   186 KRMLRKLIRLLASEDLPIVIVD--KANNYLGVGFTRWLQMVNCHGSTIFTSPRRDGWDIK--LSV 246
            .|..:|..:|...:.| .|:||  |..|...:.:.| |:........|:.|. .|.||..  ..|
  Rat   179 LRSYQKAAKLFQGQIL-FVLVDSGKRENGKVIAYFR-LKESQLPALAIYESV-DDKWDALTITEV 240

  Fly   247 RMESTR----GYLR-YIARNRQPE 265
            .:|..:    |:|: .:.|:::.|
  Rat   241 TVEKVQSFCNGFLKGMLLRDQKAE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 17/76 (22%)
Erp27NP_001100095.1 PDI_b_family 43..139 CDD:239279 22/89 (25%)
Thioredoxin_6 64..250 CDD:290560 46/203 (23%)
PDI_b'_family 156..253 CDD:239280 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.