DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and Pdia3

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_059015.2 Gene:Pdia3 / 29468 RGDID:68430 Length:510 Species:Rattus norvegicus


Alignment Length:298 Identity:60/298 - (20%)
Similarity:110/298 - (36%) Gaps:74/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PPLTEVDRKSPGGRFTFDGPKVVAFH---FVKNRHGDTLDKWISLLDELAQEY--AG-RILFGLR 79
            |.:||.::....|:     ..:.|::   :.||..|.  :.|.:.:..:|:.:  || ::.|.  
  Rat   250 PHMTEDNKDLIQGK-----DLLTAYYDVDYEKNTKGS--NYWRNRVMMVAKTFLDAGHKLNFA-- 305

  Fly    80 DISNIGEFNPNLNPDDFG-SYRKGLPPRIYGKDCEGRVYDMHKLV--NAKYLREFCDQLLADQLF 141
             :::...|:..|:  ||| ....|..|.:..:..:|..:.|.:..  :.|.|..|..:.....|.
  Rat   306 -VASRKTFSHELS--DFGLESTTGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQEYFDGNLK 367

  Fly   142 RAVVLGATASLDSKPM--------------NYFELREESSSDMLVMLYDPACYYW----PIQKRM 188
            |        .|.|:|:              ::.::......|:|:..|.|.|.:.    |..|.:
  Rat   368 R--------YLKSEPIPETNEGPVKVVVAESFDDIVNAEDKDVLIEFYAPWCGHCKNLEPKYKEL 424

  Fly   189 LRKLIRLLASEDLPIVIV-------DKANNYLGVGFTRWLQMVNCHGSTIFTSPRRDGWDIKLSV 246
            ..||     |:|..|||.       |..:.|...||           .||:.||.......|...
  Rat   425 GEKL-----SKDPNIVIAKMDATANDVPSPYEVKGF-----------PTIYFSPANKKLTPKKYE 473

  Fly   247 RMESTRGYLRYIARN-RQPELIDFDADGEPRALEQAVE 283
            .......::.|:.|. ..|.:|.   :.:|:..::|.|
  Rat   474 GGRELNDFISYLQREATNPPIIQ---EEKPKKKKKAQE 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 25/121 (21%)
Pdia3NP_059015.2 ER_PDI_fam 31..492 CDD:273457 55/277 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..510 5/23 (22%)
Prevents secretion from ER 507..510 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.