DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and P4hb

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_037130.2 Gene:P4hb / 25506 RGDID:3244 Length:509 Species:Rattus norvegicus


Alignment Length:367 Identity:65/367 - (17%)
Similarity:124/367 - (33%) Gaps:116/367 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KTYTIDNNSIPWILWL-----PPLTEVDRKSPGGRFTFDGPKVVAFHFVKNRHGDTLDKWISLLD 64
            |.||....:...:.||     |..|.:. .:.......|..:|....|.|:...|:..:::    
  Rat   116 KEYTAGREADDIVNWLKKRTGPAATTLS-DTAAAESLVDSSEVTVIGFFKDAGSDSAKQFL---- 175

  Fly    65 ELAQEYAGRILFGLRDISNI---------------------GEFNPNLNPD---DFGSYRKGLP- 104
             ||.|....|.||:...|::                     ..|...:..:   ||..:.: || 
  Rat   176 -LAAEAVDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEITKEKLLDFIKHNQ-LPL 238

  Fly   105 ---------PRIYGKDCEGRV----------YDMHKLVNAKYLRE-FCDQLLADQLFRAVVLGAT 149
                     |:|:|.:.:..:          || .||.|.|...| |..::|      .:.:.:.
  Rat   239 VIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYD-GKLSNFKKAAEGFKGKIL------FIFIDSD 296

  Fly   150 ASLDSKPMNYFEL-REESSSDMLVML------YDPA------------CYYW---PIQKRML--- 189
            .:.:.:.:.:|.| :||..:..|:.|      |.|.            |:::   .|:..::   
  Rat   297 HTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITQFCHHFLEGKIKPHLMSQE 361

  Fly   190 ------RKLIRLLASEDLPIVIVDKANNYLGVGFTRWLQMVNCHGSTIFTSPRRDGWDIKLS--- 245
                  ::.:::|..::...|..|:..|.....:..|     | |.....:|.   || ||.   
  Rat   362 LPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPW-----C-GHCKQLAPI---WD-KLGETY 416

  Fly   246 --------VRMESTRGYLRYIARNRQPELIDFDADGEPRALE 279
                    .:|:||...:..:..:..|.|..|.|..:...::
  Rat   417 KDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVID 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 31/163 (19%)
P4hbNP_037130.2 ER_PDI_fam 26..476 CDD:273457 65/367 (18%)
Prevents secretion from ER 506..509
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.