DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and PDILT

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_777584.1 Gene:PDILT / 204474 HGNCID:27338 Length:584 Species:Homo sapiens


Alignment Length:270 Identity:51/270 - (18%)
Similarity:103/270 - (38%) Gaps:69/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILWLPPLTEVDRKSPGGRFTFDGPKVVAFHFVKNRHGDTLDKWISLLDELAQEYAG------RIL 75
            ::||  ..::.:|:    |.|:..:.|| .||.:|....:..:..|.:|:|:.:..      .:.
Human   145 VVWL--RRQISQKA----FLFNSSEQVA-EFVISRPLVIVGFFQDLEEEVAELFYDVIKDFPELT 202

  Fly    76 FGLRDISN-IGEFNPNLNPDDFGSYRKGLPPRIYGKDCEGRVYDMHKLVNAKYLREFCDQLLADQ 139
            ||:..|.| ||.|:..|  |....::|            |::.:..||:|....::..::::...
Human   203 FGVITIGNVIGRFHVTL--DSVLVFKK------------GKIVNRQKLINDSTNKQELNRVIKQH 253

  Fly   140 LFRAVVLGATASLD-------SKPMNYFELREESSSDMLVMLYDPACYYWPIQKRMLRKLIRLLA 197
            |...|:...|.:.|       ...|..|..:...|..:::..|..|      .|....|::.:|.
Human   254 LTDFVIEYNTENKDLISELHIMSHMLLFVSKSSESYGIIIQHYKLA------SKEFQNKILFILV 312

  Fly   198 SEDLP----------IVIVDKANNYLGVGFTRWLQMVNCHGSTIFTSPRRDGWDIKLSVRMESTR 252
            ..|.|          :..||..:          :|::|......:..|..|       :..||.:
Human   313 DADEPRNGRVFKYFRVTEVDIPS----------VQILNLSSDARYKMPSDD-------ITYESLK 360

  Fly   253 GYLR-YIARN 261
            .:.| ::::|
Human   361 KFGRSFLSKN 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 26/120 (22%)
PDILTNP_777584.1 YbbN 46..501 CDD:331940 51/270 (19%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 581..584
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.