DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and Y73B6BL.12

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_500961.2 Gene:Y73B6BL.12 / 190648 WormBaseID:WBGene00022236 Length:136 Species:Caenorhabditis elegans


Alignment Length:109 Identity:21/109 - (19%)
Similarity:38/109 - (34%) Gaps:35/109 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DTLDKWI---------------SLLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYRKGL 103
            |:.:.||               .:.|.:|:|.||::.|.            .::.|.:....:|.
 Worm    33 DSSEPWIVDFFAPWCGHCIQFAPIYDRIAKELAGKVNFA------------KIDCDQWPGVCQGA 85

  Fly   104 PPRIY-------GKDCEGRVYDMHKLVNAKYLREFCDQLLADQL 140
            ..|.|       ||....|..|....:..::..:|. |::..||
 Worm    86 QVRAYPTIRLYTGKTGWSRQGDQGIGIGTQHKEQFI-QIVRQQL 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 18/101 (18%)
Y73B6BL.12NP_500961.2 PDI_a_ERdj5_C 18..121 CDD:239302 17/99 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.