DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and pdi-6

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_509190.1 Gene:pdi-6 / 180974 WormBaseID:WBGene00015168 Length:440 Species:Caenorhabditis elegans


Alignment Length:197 Identity:38/197 - (19%)
Similarity:61/197 - (30%) Gaps:50/197 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WISLLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYR-KGLPP-RIYGKDCEGRVYDMHK 121
            |......|..||. :....|:.::.:|..:...:....|.|. :|.|. :|:|.|         |
 Worm    53 WCGHCKSLVPEYK-KAASALKGVAKVGAVDMTQHQSVGGPYNVQGFPTLKIFGAD---------K 107

  Fly   122 LVNAKYLREFCDQLLADQLFRAVVLGATASLDSK-----------------------------PM 157
            .....|..:...|.:||.:........:|.|..|                             ..
 Worm   108 KKPTDYNGQRTAQAIADSVLAEAKKAVSARLGGKSSGSSSSGSGSGSGKRGGGGSGNEVVELTDA 172

  Fly   158 NYFELREESSSDMLVMLYDPACYY-------WPIQKRMLRKLIRLLASEDLPIVIVDKANNYLGV 215
            |:.:|...|....||..:.|.|.:       |......|:..:||.|.:.....:|  ||.:...
 Worm   173 NFEDLVLNSKDIWLVEFFAPWCGHCKSLEPQWKAAASELKGKVRLGALDATVHTVV--ANKFAIR 235

  Fly   216 GF 217
            ||
 Worm   236 GF 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 15/76 (20%)
pdi-6NP_509190.1 PDI_a_P5 25..127 CDD:239299 18/83 (22%)
PDI_a_P5 165..269 CDD:239299 17/75 (23%)
P5_C 278..407 CDD:239281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.