Sequence 1: | NP_650032.1 | Gene: | CG14695 / 41314 | FlyBaseID: | FBgn0037850 | Length: | 289 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509190.1 | Gene: | pdi-6 / 180974 | WormBaseID: | WBGene00015168 | Length: | 440 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 38/197 - (19%) |
---|---|---|---|
Similarity: | 61/197 - (30%) | Gaps: | 50/197 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 WISLLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYR-KGLPP-RIYGKDCEGRVYDMHK 121
Fly 122 LVNAKYLREFCDQLLADQLFRAVVLGATASLDSK-----------------------------PM 157
Fly 158 NYFELREESSSDMLVMLYDPACYY-------WPIQKRMLRKLIRLLASEDLPIVIVDKANNYLGV 215
Fly 216 GF 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14695 | NP_650032.1 | Thioredoxin_6 | <20..134 | CDD:290560 | 15/76 (20%) |
pdi-6 | NP_509190.1 | PDI_a_P5 | 25..127 | CDD:239299 | 18/83 (22%) |
PDI_a_P5 | 165..269 | CDD:239299 | 17/75 (23%) | ||
P5_C | 278..407 | CDD:239281 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0191 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |