DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and Y49E10.4

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_499613.1 Gene:Y49E10.4 / 176664 WormBaseID:WBGene00013030 Length:436 Species:Caenorhabditis elegans


Alignment Length:308 Identity:62/308 - (20%)
Similarity:96/308 - (31%) Gaps:92/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNSIPWIL-----W------LPPLTEVDRKSPGGRFTFDGPKVVAFHFVKNRHGDTLDKWISLLD 64
            |:..||::     |      |.|..:...:..|||..|                       ..||
 Worm   170 NSKEPWMVEFFAPWCGHCQKLEPEWKKAAEEMGGRVKF-----------------------GALD 211

  Fly    65 ELAQEYAGRILFGLRDISNIGEFNPNLNP------------------------DDFGSYRKGLPP 105
            ..|.|...: .||:|....|..|.|..:.                        ||||:     .|
 Worm   212 ATAHESIAQ-KFGIRGFPTIKFFAPGTSSASDAEDYQGGRTSTDLISYAESKYDDFGA-----AP 270

  Fly   106 RIY---GKDCEGRVYDMHKLVNAKYLREFCDQLLADQLFRAVVLGATASLDSKPMNYFELREESS 167
            .:.   ||.....|....:|....:|....|.....:..:..:|...|::..|....:...|..:
 Worm   271 EVVEGTGKAVVETVCKDKQLCIFTFLPSIFDCQSKCRKQKIDMLNELATIFKKRSFGWVWMEGGA 335

  Fly   168 SDMLVMLYDPACYYWPIQKRMLRKLIRLLASEDLPIVIVDKANNYLGV---GFTRWLQMVNCHGS 229
            .:.:...::...|.:|:...|..|  :::.|..:....||....:|..   |..|.|::...|.|
 Worm   336 QENVQRAFEIGDYGFPVLIAMSPK--KMMYSTQIGQFSVDGIKEFLNAVNYGKGRVLEIKPTHLS 398

  Fly   230 TIF-----TSPRRDGWDIKLSVRMESTRGYLRYIARNRQPELIDFDAD 272
            ..|     |.| .||.|.:|.| ||..             :|.|.|.|
 Worm   399 NNFLKIVETQP-WDGKDKELPV-MEDI-------------DLSDVDMD 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 26/140 (19%)
Y49E10.4NP_499613.1 PDI_a_P5 26..127 CDD:239299
PDI_a_P5 156..259 CDD:239299 20/112 (18%)
P5_C 269..405 CDD:239281 25/137 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.