DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and C14B9.2

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_498775.2 Gene:C14B9.2 / 176147 WormBaseID:WBGene00015752 Length:618 Species:Caenorhabditis elegans


Alignment Length:254 Identity:61/254 - (24%)
Similarity:101/254 - (39%) Gaps:47/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PPLTEVDRKSPGGRFTFDGPKVVAFH----FVKNRHGDTLDKWISLLDELAQEY-AGRILFGLRD 80
            |.:.::.:|:...|:| ..|.||.::    .|:.|.|.  :.|.|.:..:||:| ..:..|.:.|
 Worm   364 PLVGKMTKKNAATRYT-KKPLVVVYYNADFSVQYREGS--EYWRSKVLNIAQKYQKDKYKFAVAD 425

  Fly    81 ISNIGEFNPNLNPDDFGSYRKGLPPRIYGKDCEGRVYDMH------KLVNAKYLREFCDQLLADQ 139
            ..   ||...|  ::.|....||...:.....:|:.|.|:      :|  .:.|..|..|:.:.:
 Worm   426 EE---EFAKEL--EELGLGDSGLEHNVVVFGYDGKKYPMNPDEFDGEL--DENLEAFMKQISSGK 483

  Fly   140 LFRAVVLGATASLDSK-PM------NYFELREESSSDMLVMLYDPACYYWPIQKRMLRKLIRL-- 195
            . :|.|..|.|..|.| |:      |:.::..:.|.|:|:..|.|.|.:.   |....|.:.|  
 Worm   484 A-KAHVKSAPAPKDDKGPVKTVVGSNFDKIVNDESKDVLIEFYAPWCGHC---KSFESKYVELAQ 544

  Fly   196 ----------LASEDLPIVIVDKANNYLGVGF-TRWLQMVNCHGSTIFTSPRRDGWDIK 243
                      ||..|  ..|.|..:.:...|| |.:..........|..|..||..|:|
 Worm   545 ALKKTQPNVVLAKMD--ATINDAPSQFAVEGFPTIYFAPAGKKSEPIKYSGNRDLEDLK 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 29/123 (24%)
C14B9.2NP_498775.2 pdi_dom 41..138 CDD:273454
ER_PDI_fam 147..616 CDD:273457 61/254 (24%)
pdi_dom 152..253 CDD:273454
Thioredoxin_like 256..361 CDD:294274
PDI_b'_ERp72_ERp57 366..476 CDD:239371 27/119 (23%)
PDI_a_PDI_a'_C 500..604 CDD:239293 25/107 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.