DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and Pdia3

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_031978.2 Gene:Pdia3 / 14827 MGIID:95834 Length:505 Species:Mus musculus


Alignment Length:298 Identity:62/298 - (20%)
Similarity:113/298 - (37%) Gaps:74/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PPLTEVDRKSPGGRFTFDGPKVVAFH---FVKNRHGDTLDKWISLLDELAQEY--AG-RILFGLR 79
            |.:||.::....|:     ..:.|::   :.||..|.  :.|.:.:..:|:::  || ::.|.  
Mouse   245 PHMTEDNKDLIQGK-----DLLTAYYDVDYEKNAKGS--NYWRNRVMMVAKKFLDAGHKLNFA-- 300

  Fly    80 DISNIGEFNPNLNPDDFG-SYRKGLPPRIYGKDCEGRVYDMHKLV--NAKYLREFCDQLLADQLF 141
             :::...|:..|:  ||| ....|..|.:..:..:|..:.|.:..  :.|.|.:|..:.....|.
Mouse   301 -VASRKTFSHELS--DFGLESTTGEVPVVAIRTAKGEKFVMQEEFSRDGKALEQFLQEYFDGNLK 362

  Fly   142 RAVVLGATASLDSKPM--------------NYFELREESSSDMLVMLYDPACYYW----PIQKRM 188
            |        .|.|:|:              |:.::..|...|:|:..|.|.|.:.    |..|.:
Mouse   363 R--------YLKSEPIPESNEGPVKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKEL 419

  Fly   189 LRKLIRLLASEDLPIVIV-------DKANNYLGVGFTRWLQMVNCHGSTIFTSPRRDGWDIKLSV 246
            ..||     |:|..|||.       |..:.|...||           .||:.||.......|...
Mouse   420 GEKL-----SKDPNIVIAKMDATANDVPSPYEVKGF-----------PTIYFSPANKKLTPKKYE 468

  Fly   247 RMESTRGYLRYIARN-RQPELIDFDADGEPRALEQAVE 283
            .......::.|:.|. ..|.:|.   :.:|:..::|.|
Mouse   469 GGRELNDFISYLQREATNPPIIQ---EEKPKKKKKAQE 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 25/121 (21%)
Pdia3NP_031978.2 ER_PDI_fam 26..487 CDD:273457 57/277 (21%)
Thioredoxin 27..131 CDD:278513
PDI_b_ERp57 135..240 CDD:239367
PDI_b'_ERp72_ERp57 244..357 CDD:239371 25/123 (20%)
PDI_a_PDI_a'_C 377..480 CDD:239293 25/118 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..505 5/23 (22%)
Prevents secretion from ER. /evidence=ECO:0000250 502..505 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.