DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and M04D5.1

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001251622.1 Gene:M04D5.1 / 13182108 WormBaseID:WBGene00014807 Length:332 Species:Caenorhabditis elegans


Alignment Length:264 Identity:56/264 - (21%)
Similarity:88/264 - (33%) Gaps:101/264 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DGPKVVAF-HFVKNRHGDTLDKWISLLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYRK 101
            |..:||.. :|.|.      |.:::.:.||..|....|.:|:.|.|.:.   .::|.|::|..  
 Worm     3 DKKRVVTLAYFEKT------DFYLARIFELMYERDNDIFYGITDSSEVA---ASVNLDEYGFV-- 56

  Fly   102 GLPPRIYGKDCEGRVYDMHKLVNAKYLREFCDQLLADQLFRAVVLGATASLDSKPMNYFELREES 166
                 |..|..|||           .:|.|.:|.|| |.:.|.:..           |.|.:   
 Worm    57 -----IITKSKEGR-----------EMRYFSEQDLA-QDYSAFIRW-----------YHEFK--- 90

  Fly   167 SSDMLVMLYDPACYYWPIQKRMLRKLIRLLASEDLPIVIVDKANNYLGVGFTRWLQMVNC----- 226
                                              ||:||..:.|....|. ||...||:.     
 Worm    91 ----------------------------------LPLVITSRQNMKDAVE-TRQFNMVHVLYIKK 120

  Fly   227 ----HGSTI--FT-SPRRDGWDIKLSVRMESTRGYLRYIARNRQ----PELIDFDADGEPRALEQ 280
                :.|||  || :.||.....|:..       ::|::..:|.    |:.|.|..:..|.....
 Worm   121 SDTDYNSTISKFTDTARRFHGRFKILF-------FIRHLDESRDNTYIPKRIRFLINYSPTTTPS 178

  Fly   281 AVEY 284
            :|.|
 Worm   179 SVIY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 23/96 (24%)
M04D5.1NP_001251622.1 ER_PDI_fam <2..329 CDD:273457 56/264 (21%)
Thioredoxin_like 229..311 CDD:294274
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.