DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and Pdia4

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001355685.1 Gene:Pdia4 / 12304 MGIID:104864 Length:699 Species:Mus musculus


Alignment Length:244 Identity:46/244 - (18%)
Similarity:81/244 - (33%) Gaps:100/244 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SLLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGS---------YRKG-LPPRIYG----KD 111
            ::|||..:::|                   :.|::|.|         ::|| |.|.|..    |:
Mouse   531 AILDESGKKFA-------------------MEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKN 576

  Fly   112 CEGRVYDMHKLVNAKYLREFCDQLLADQLFRAVVLGATASLDSKPMNYFELREESSSDMLVMLYD 176
            .:|.|                 :::..:.|.|:|:                  :...|:|:..|.
Mouse   577 NKGPV-----------------KVVVGKTFDAIVM------------------DPKKDVLIEFYA 606

  Fly   177 PACYYW----PIQKRMLRKLIRLLASEDLPIVIVDKANN------YLGVGFTRWLQMVNCHGSTI 231
            |.|.:.    ||...:.:|   ....:||.|..:|...|      |...||           .||
Mouse   607 PWCGHCKQLEPIYTSLGKK---YKGQKDLVIAKMDATANDITNDQYKVEGF-----------PTI 657

  Fly   232 FTSPRRDGWDIKLSVRMESTRGYLRYIARNRQPELIDFDADGEPRALEQ 280
            :.:|   ..|.|..::.|.....|.::::     .||..|....|..|:
Mouse   658 YFAP---SGDKKNPIKFEGGNRDLEHLSK-----FIDEHATKRSRTKEE 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 15/86 (17%)
Pdia4NP_001355685.1 pdi_dom 63..164 CDD:273454
ER_PDI_fam 173..691 CDD:273457 44/235 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.