DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and ERP27

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_689534.1 Gene:ERP27 / 121506 HGNCID:26495 Length:273 Species:Homo sapiens


Alignment Length:161 Identity:29/161 - (18%)
Similarity:54/161 - (33%) Gaps:64/161 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IDNNSIPWILWLPPLTEVDRKSPGGRFTFDGPKVVAFH--FVKNRHGDTLDKWISLLDELAQEYA 71
            |:.||:..:....|:|.:      |.|.    .|:..|  .:.|:.....::.:....:.|:.:.
Human   136 IEINSLHMVTEYNPVTVI------GLFN----SVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQ 190

  Fly    72 GRILFGLRDISNIGEFNPNLNPDDFGSYRKGLPPRIYGKDCEGRVYDMHKL-------------- 122
            |:|||.|.| |.:.|                          .|:|....||              
Human   191 GKILFILVD-SGMKE--------------------------NGKVISFFKLKESQLPALAIYQTL 228

  Fly   123 -----------VNAKYLREFCDQLLADQLFR 142
                       |:.::::.|||..|:.:|.:
Human   229 DDEWDTLPTAEVSVEHVQNFCDGFLSGKLLK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 23/140 (16%)
ERP27NP_689534.1 Thioredoxin_6 64..250 CDD:372755 25/150 (17%)
PDIA3-binding site. /evidence=ECO:0000269|PubMed:16940051 230..233 0/2 (0%)
Prevents secretion from ER. /evidence=ECO:0000305|PubMed:16940051 270..273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.