DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and Pdia4

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_446301.2 Gene:Pdia4 / 116598 RGDID:619835 Length:643 Species:Rattus norvegicus


Alignment Length:244 Identity:45/244 - (18%)
Similarity:81/244 - (33%) Gaps:100/244 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SLLDELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGS---------YRKG-LPPRIYG----KD 111
            ::|||..:::|                   :.|::|.|         ::|| |.|.|..    |:
  Rat   475 AILDESGKKFA-------------------MEPEEFDSDALREFVMAFKKGKLKPVIKSQPVPKN 520

  Fly   112 CEGRVYDMHKLVNAKYLREFCDQLLADQLFRAVVLGATASLDSKPMNYFELREESSSDMLVMLYD 176
            .:|.|                 :::..:.|.|:|:                  :...|:|:..|.
  Rat   521 NKGPV-----------------RVVVGKTFDAIVM------------------DPKKDVLIEFYA 550

  Fly   177 PACYYW----PIQKRMLRKLIRLLASEDLPIVIVDKANN------YLGVGFTRWLQMVNCHGSTI 231
            |.|.:.    |:...:.:|   ....:||.|..:|...|      |...||           .||
  Rat   551 PWCGHCKQLEPVYTSLGKK---YKGQKDLVIAKMDATANDITNDRYKVEGF-----------PTI 601

  Fly   232 FTSPRRDGWDIKLSVRMESTRGYLRYIARNRQPELIDFDADGEPRALEQ 280
            :.:|   ..|.|..::.|.....|.::::     .||..|....|..|:
  Rat   602 YFAP---SGDKKNPIKFEGGNRDLEHLSK-----FIDEHATKRSRTKEE 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 15/86 (17%)
Pdia4NP_446301.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..58
pdi_dom 65..166 CDD:273454
CXXC. /evidence=ECO:0000250|UniProtKB:P08003 89..92
ER_PDI_fam 175..635 CDD:273457 43/235 (18%)
CXXC. /evidence=ECO:0000250|UniProtKB:P08003 553..556 1/2 (50%)
Prevents secretion from ER 640..643 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.