DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and PDIA5

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_006801.1 Gene:PDIA5 / 10954 HGNCID:24811 Length:519 Species:Homo sapiens


Alignment Length:38 Identity:12/38 - (31%)
Similarity:21/38 - (55%) Gaps:4/38 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LDSKPMNYFELREESSSDMLVMLYDPACYYWPIQKRML 189
            |||: .::..|.::....:|:|.|.|.|   .:.|||:
Human   156 LDSE-KDFRRLLKKEEKPLLIMFYAPWC---SMCKRMM 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560
PDIA5NP_006801.1 PDI_b_PDIR_N 28..139 CDD:239365
PDI_a_PDIR 152..256 CDD:239295 12/38 (32%)
PTZ00102 168..512 CDD:240266 8/25 (32%)
PDI_a_PDIR 277..379 CDD:239295
PDI_a_PDIR 398..501 CDD:239295
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 516..519
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.