DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14695 and pdilt

DIOPT Version :9

Sequence 1:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster
Sequence 2:XP_017952839.2 Gene:pdilt / 100491254 XenbaseID:XB-GENE-963740 Length:566 Species:Xenopus tropicalis


Alignment Length:330 Identity:56/330 - (16%)
Similarity:105/330 - (31%) Gaps:132/330 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVKTYTIDNNSIPWILWLPPLTEVDRKSPGGRFT-FDGPKVVAFHFV--KNRHGDTLDKWISLLD 64
            |::||.:|           .:||.:.::   :.| ||.|  |..|.:  .::...:........:
 Frog   288 LIRTYIMD-----------VVTEYNLET---QVTIFDVP--VGSHILLFTSKTSQSFGTIYENFE 336

  Fly    65 ELAQEYAGRILFGLRDISNIGEFNPNLNPDDFGSYRKGLPPRIYGKDCEGRVYDMHKL------- 122
            ..|.|:.|:::|.|.|...                     ||      .||:::..::       
 Frog   337 SAALEFRGKLVFILVDTDE---------------------PR------NGRIFEYFRITEVDTPA 374

  Fly   123 ------------------VNAKYLREFCDQLLADQLFRAVVLGATASLDSKPMNYFELREESSSD 169
                              ||.:.||.||...|..:        |....||         ||...|
 Frog   375 VRILNLTSDVQYRMPADEVNFENLRRFCRSYLDGK--------AKPKRDS---------EEIPKD 422

  Fly   170 MLVMLYDPACYYWPIQKRMLRKLIRLLASEDLPIVIVDKANNYLGVGFTRWLQMVNCHGSTIFTS 234
                        |.      :..::||..::...|..:|..:...:.:..|.|  .|.|  :|..
 Frog   423 ------------WD------KNPVKLLVGKNFNHVAFNKTTHTFIMFYAPWSQ--ECKG--LFPI 465

  Fly   235 PRRDGWDIKLS-----------VRMESTRGYLRYIARNRQPELIDFDADGEPRALEQAVE----- 283
                 |: :|.           .:::.|...::.:..:|.|....|.|..:.:::....|     
 Frog   466 -----WE-ELGRTYQNHKNVTIAKIDCTANDIQLMVLDRYPYFRYFPAGSDTKSIRYTGERTLSA 524

  Fly   284 YIQYL 288
            :|:||
 Frog   525 FIEYL 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 24/141 (17%)
pdiltXP_017952839.2 ER_PDI_fam 82..532 CDD:273457 56/330 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.