DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-2 and ADH6

DIOPT Version :9

Sequence 1:NP_524311.1 Gene:Sodh-2 / 41313 FlyBaseID:FBgn0022359 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_014051.3 Gene:ADH6 / 855368 SGDID:S000004937 Length:360 Species:Saccharomyces cerevisiae


Alignment Length:335 Identity:96/335 - (28%)
Similarity:150/335 - (44%) Gaps:48/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTKPMIIGHEAAGVVAKLGKKVTT-LKVGDRVAIE 91
            |.::.:.:::.|:||||:| .|.|..|:  :..|:::|||..|.|.|||.|..: ||||.||.:.
Yeast    33 DHDIDIKIEACGVCGSDIH-CAAGHWGN--MKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVG 94

  Fly    92 PGV-PCRYCDHCKQGRYNLCADMVFCATPPY-DG--------NLTRYYKHAADFCFKLPDHVSME 146
            ..| .|..||.||......|...|...:.|| ||        |..|.::|   |...:|:::...
Yeast    95 AQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDGYVSQGGYANYVRVHEH---FVVPIPENIPSH 156

  Fly   147 EGALLEPLSVG---VHA-CRRAGVGLGSKVLILGAGPIGLVTLLAAQAMGASEILITDLVQQRLD 207
               |..||..|   |:: ..|.|.|.|.||.|:|.|.||.:..|.::||||...:|:...::|.|
Yeast   157 ---LAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTLISKAMGAETYVISRSSRKRED 218

  Fly   208 VAKELGATHTL-LLQRDQSAEETVKVVHQTMSEVPDKSIDCCGAESSARLAIF--ATRSGGVVVV 269
             |.::||.|.: .|:.....|:        ..:..|..:.|..:.:.....|.  |.:.||.:|.
Yeast   219 -AMKMGADHYIATLEEGDWGEK--------YFDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVS 274

  Fly   270 VGMGAPEVKLPL----INALAREIDIRGVFRYCNDYSAALALVASG--KVNVKRLVTHHYDITET 328
            :.:......|.|    :.|::......|..:..|.   .|.||:..  |:.|:.|......:   
Yeast   275 ISIPEQHEMLSLKPYGLKAVSISYSALGSIKELNQ---LLKLVSEKDIKIWVETLPVGEAGV--- 333

  Fly   329 AEAFETSRRG 338
            .||||...:|
Yeast   334 HEAFERMEKG 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-2NP_524311.1 PLN02702 4..346 CDD:215378 96/335 (29%)
sorbitol_DH 8..349 CDD:176188 96/335 (29%)
ADH6NP_014051.3 CAD1 8..352 CDD:176186 96/335 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.