DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-2 and AST1

DIOPT Version :9

Sequence 1:NP_524311.1 Gene:Sodh-2 / 41313 FlyBaseID:FBgn0022359 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_009484.2 Gene:AST1 / 852209 SGDID:S000000165 Length:429 Species:Saccharomyces cerevisiae


Alignment Length:412 Identity:89/412 - (21%)
Similarity:149/412 - (36%) Gaps:117/412 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GIEDLRLEQR---PIPEIADDEVLLAMDSVGICGSDVH----YLA--HGRIGDFVLTKPMIIGHE 67
            |..|...|::   |||:   :::::.:.:||:...|:.    |.:  :|.||         :|.|
Yeast    60 GPMDFSYEKKIKTPIPK---NKIVVRVSNVGLNPVDMKIRNGYTSSIYGEIG---------LGRE 112

  Fly    68 AAGVVAKLGKKVT-TLKVGDRVAIEPGVPCRYCDHCKQGRYNLCADMVFCATPPYDGNLTRYYKH 131
            .:||:.::|:.:. ...|||.|.   |:  .|..|...|    |........|..|..|.|    
Yeast   113 YSGVITEVGENLNYAWHVGDEVY---GI--YYHPHLAVG----CLQSSILVDPKVDPILLR---- 164

  Fly   132 AADFCFKLPDHVSMEEGALLEPLSVGVHACRRAGVGL------------GSKVLIL-GAGPIGL- 182
                    |:.||.||.|       |...|...|..:            .|.|||. |...:|: 
Yeast   165 --------PESVSAEEAA-------GSLFCLATGYNILNKLSKNKYLKQDSNVLINGGTSSVGMF 214

  Fly   183 -VTLLAAQAMGASEILIT------DLVQQRL-DVAKELGATHTLLLQRDQSAEETVKVVHQ---- 235
             :.||........:::|.      .::|::. |:|.|: .....|..|.:|::...|::.:    
Yeast   215 VIQLLKRHYKLQKKLVIVTSANGPQVLQEKFPDLADEM-IFIDYLTCRGKSSKPLRKMLEEKKIS 278

  Fly   236 TMSEVPDKS-------------IDCCGAESSARLAIFATRSGGV-VVVVGMGAPEVKLPLI---- 282
            ....|.||.             :|..|.......:......||. |..||......|..:.    
Yeast   279 QYDPVEDKETILNYNEGKFDVVLDFVGGYDILSHSSSLIHGGGAYVTTVGDYVANYKEDIFDSWD 343

  Fly   283 --NALAREI--DIRGVFRYCNDYSAALALVASGKVN-------------VKRLVTHHYDITETAE 330
              :|.||::  .|...:.|.:.|....|..||...:             ||.:|...||..:..|
Yeast   344 NPSANARKMFGSIIWSYNYTHYYFDPNAKTASANNDWIEQCGDFLKNGTVKCVVDKVYDWKDHKE 408

  Fly   331 AFE--TSRRGTGGAIKVMIHVQ 350
            ||.  .::|..|   |::::|:
Yeast   409 AFSYMATQRAQG---KLIMNVE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-2NP_524311.1 PLN02702 4..346 CDD:215378 88/406 (22%)
sorbitol_DH 8..349 CDD:176188 88/409 (22%)
AST1NP_009484.2 AST1_like 50..426 CDD:176209 88/409 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.