DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-2 and YCR102C

DIOPT Version :9

Sequence 1:NP_524311.1 Gene:Sodh-2 / 41313 FlyBaseID:FBgn0022359 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_010026.1 Gene:YCR102C / 850466 SGDID:S000000699 Length:368 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:59/279 - (21%)
Similarity:99/279 - (35%) Gaps:68/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DNLTAVLHGIEDLRLEQRPIPEIADDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTKPMIIGHEA 68
            |....|..|:        ||||:.:..||:  .::.:.|:...: ||  |...|..:..|:|.:|
Yeast     8 DGKAVVKEGV--------PIPELEEGFVLI--KTLAVAGNPTDW-AH--IDYKVGPQGSILGCDA 59

  Fly    69 AGVVAKLGKKV--TTLKVGDRV-AIEPGVPCRYCDHCKQGRYNLCADMVFCATPPYDGNLTRYYK 130
            ||.:.|||..|  ....:||.: ....|...|:                     |.:|....|..
Yeast    60 AGQIVKLGPAVDPKDFSIGDYIYGFIHGSSVRF---------------------PSNGAFAEYSA 103

  Fly   131 HAADFCFKLPDH-------------VSMEEGALLEPLSV---GVHACRRAGVGL----------G 169
            .:....:|.|:.             |...|||...|:|:   |:......|:.|          |
Yeast   104 ISTVVAYKSPNELKFLGEDVLPAGPVRSLEGAATIPVSLTTAGLVLTYNLGLNLKWEPSTPQRNG 168

  Fly   170 SKVLILGAGPIGLVTLLAAQAMGASEILITDLVQQRLDVAKELGATHTLLLQRDQSAEETVKVVH 234
            ..:|..||..:|...:..|..:.....:|....::...:.||.||.. |....|....|.:|..:
Yeast   169 PILLWGGATAVGQSLIQLANKLNGFTKIIVVASRKHEKLLKEYGADQ-LFDYHDIDVVEQIKHKY 232

  Fly   235 QTMSEVPDKSIDCCGAESS 253
            ..:|.:    :||...:::
Yeast   233 NNISYL----VDCVANQNT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-2NP_524311.1 PLN02702 4..346 CDD:215378 59/279 (21%)
sorbitol_DH 8..349 CDD:176188 58/275 (21%)
YCR102CNP_010026.1 enoyl_reductase_like 1..367 CDD:176211 59/279 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.