DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-2 and CG4836

DIOPT Version :9

Sequence 1:NP_524311.1 Gene:Sodh-2 / 41313 FlyBaseID:FBgn0022359 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001138085.1 Gene:CG4836 / 42387 FlyBaseID:FBgn0270925 Length:1224 Species:Drosophila melanogaster


Alignment Length:332 Identity:109/332 - (32%)
Similarity:180/332 - (54%) Gaps:19/332 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RPIPEIADDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTKPMIIGHEAAGVVAKLGKKVTTLKVG 85
            :|.|:  |.:||:...||.:..||:|...:|...    .:.|.:||:|.|:|.:||:.|..|.||
  Fly   901 KPRPK--DFDVLIRTGSVAVSNSDIHVYENGNRD----MEAMSLGHDATGIVEELGRCVQHLHVG 959

  Fly    86 DRVAIEPGVPCRYCDHCKQGRYNLCADMVFCATPPYDGNLTRYYKHAADFCFKLPDHVSMEEGAL 150
            |||.:|..:.|..||.||:|.||:|:.:|      |:|.|:.|..|.||.|.:||:.:|||.|||
  Fly   960 DRVVMESALSCGICDLCKKGLYNMCSGLV------YNGFLSTYQTHPADLCHRLPESISMEAGAL 1018

  Fly   151 LEPLSVGVHACRRAGVGLGSKVLILGAGPIGLVTLLAAQAMGASEILITDLVQQRLD-VAKELGA 214
            .:.|::|..||.:|.|...|.||||||.|..:...:.|:|:||..:.|...:...|| ||::.|.
  Fly  1019 TQTLALGCQACFKANVTPTSNVLILGACPTAVAAGICAKAIGAKRVAIAGCMAPALDVVARDFGF 1083

  Fly   215 THTLLLQRDQSA--EETVKVVHQTMSEVPDKSIDCCGAESSARLAIFATRSGGVVVVVGMGAPEV 277
            .   .::.|.:|  .|.::.::....:.||..|:|..:..:..||:.|.:..||.|:....:...
  Fly  1084 Q---AVEFDSNALFGEVLEAIYSKFRDWPDCVINCSISAMTMNLAVMALQPCGVCVLAECDSECA 1145

  Fly   278 KLPLINALAREIDIRGVFRYCNDYSAALALVASGKVNVKRLVTHHYDITETAEAFETSRRGTG-G 341
            ....::.|.:.|.:...||..|.|..||.|:.||:.::::.:|..|.:::..|||..::..:. |
  Fly  1146 SFNALDVLMKNIRLVPSFRSANMYPTALQLMQSGRAHMQKFITATYPLSKADEAFRAAQHESNIG 1210

  Fly   342 AIKVMIH 348
            ..||:::
  Fly  1211 LGKVIVN 1217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-2NP_524311.1 PLN02702 4..346 CDD:215378 108/328 (33%)
sorbitol_DH 8..349 CDD:176188 109/332 (33%)
CG4836NP_001138085.1 MDR 888..1218 CDD:302572 109/332 (33%)
Tdh 893..1217 CDD:223991 109/330 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445846
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1063
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S593
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1019156at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.