DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-2 and CG16935

DIOPT Version :9

Sequence 1:NP_524311.1 Gene:Sodh-2 / 41313 FlyBaseID:FBgn0022359 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001286396.1 Gene:CG16935 / 36540 FlyBaseID:FBgn0033883 Length:357 Species:Drosophila melanogaster


Alignment Length:304 Identity:63/304 - (20%)
Similarity:115/304 - (37%) Gaps:67/304 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 HG--IEDLRLEQRPIPEIADDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTK--PMIIGHEAAGV 71
            ||  .|.|:|.:..:|:..|::||:.:.:..|..:|::.:.    |.:.:..  |.:.|:|....
  Fly    31 HGEPQEVLQLVEDKLPDPKDNQVLVKILAAPINPADINTIQ----GKYPVKPKFPAVGGNECVAE 91

  Fly    72 VAKLGKKVTTLKVGDRVAIEPGVPC-----RYCDHC--KQGRYNLCADMVFCATPPYDG-NLTRY 128
            |..:|.||...:.|..|     :|.     .:..|.  |:.:..:.:..|..|...... |.|..
  Fly    92 VICVGDKVKGFEAGQHV-----IPLASGLGTWTTHAVYKEDQLLIVSKKVGLAEAATSTVNPTTA 151

  Fly   129 YKHAADFCFKLPDHVSMEEGALLEPLSVG--VH-ACRRAGVGLGSKVLILGAGPIGLVTLLAAQA 190
            |:...||....|....::.||   ..:||  || .||..|:                      .:
  Fly   152 YRMLKDFVQLCPGDTVIQNGA---NSAVGQAVHQLCRAWGI----------------------NS 191

  Fly   191 MGASEILITDLVQQRLDVAKE------LGATHTLLLQRDQSAEETVKVVHQTMSEVPDKSIDCCG 249
            :|        :|:.|.::|:.      ||||..|    .::...|..:......:.|..:.:|.|
  Fly   192 VG--------IVRDRPEIAELKQMLQCLGATEVL----TEAEIRTSDIFKSGKLKKPRLAFNCVG 244

  Fly   250 AESSARLAIFATRSGGVVVVVGMGAPEVKLPLINALAREIDIRG 293
            .:|:..::......|.:|...||....|.:.....:.::|..||
  Fly   245 GKSATEVSRHLDNGGVLVTYGGMSREPVTVATGPLIFKDIAFRG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-2NP_524311.1 PLN02702 4..346 CDD:215378 63/304 (21%)
sorbitol_DH 8..349 CDD:176188 63/304 (21%)
CG16935NP_001286396.1 ETR 23..355 CDD:176250 63/304 (21%)
Qor 23..349 CDD:223677 63/304 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.