DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-2 and Drat

DIOPT Version :9

Sequence 1:NP_524311.1 Gene:Sodh-2 / 41313 FlyBaseID:FBgn0022359 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster


Alignment Length:285 Identity:64/285 - (22%)
Similarity:101/285 - (35%) Gaps:68/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GHEAAGVVAKLGKKVTT-----LKVGDRVAIEP--GVPCRYCDHCKQGRYNLCADMVFCATPPYD 122
            |.|.|||:..||.::|.     |::|.||.:.|  ..|..|.:              ....|.  
  Fly   145 GFEVAGVIESLGSEITEANNRGLRIGQRVIVYPFDETPAGYAE--------------LLVVPD-- 193

  Fly   123 GNLTRYYKHAADFCFKLPDHVSMEEGALLEPLSV----GVHACRRAGVGLGS-----------KV 172
                  .||..    .:||.:.||..|:|...::    .|...:.....:.|           |:
  Fly   194 ------LKHVV----PIPDSLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPKI 248

  Fly   173 LILGAGPIGLVTLLAAQ----AMGAS--EILITDLVQQRLDVAKELGATHTL----LLQRDQSAE 227
            ||:|.|.:.|..:..|.    ..||.  :|.:..|..:...:|.|:.....:    .|...|..|
  Fly   249 LIVGTGGLALWAVRIASYHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLIE 313

  Fly   228 ETVKVVHQTMSEVPDKSIDCCGAESSARLAIFATRSGGVVVVVGMGAPEVKLPLINALAREIDIR 292
            .|..|....:    |..||......|...::.....||||::....| |..||..:.|:.:.. :
  Fly   314 RTKDVCGGAV----DVVIDFGTTSRSLHRSMHCLSKGGVVLISDEVA-EKLLPKFSRLSEQYQ-Q 372

  Fly   293 GVFRYCNDYSAALA----LVASGKV 313
            .:....|..:..||    |||:.|:
  Fly   373 EIIAISNGTAEQLAELVELVANKKI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-2NP_524311.1 PLN02702 4..346 CDD:215378 64/285 (22%)
sorbitol_DH 8..349 CDD:176188 64/285 (22%)
DratNP_610293.3 Qor 142..430 CDD:223677 64/285 (22%)
MDR 144..428 CDD:302572 64/285 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.