DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and YNL134C

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_014265.3 Gene:YNL134C / 855588 SGDID:S000005078 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:442 Identity:92/442 - (20%)
Similarity:147/442 - (33%) Gaps:146/442 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TCKAAVAWEAKKPLVIEDIEVAPPKAHE--VRIKITATGVCHTD----AFTLSGADPEGLFPVVL 68
            |.||.|. |..|.:|.:||.:  |:..|  |.||..|.....||    .|.:.   |:|   .:|
Yeast     8 TMKAVVI-ENGKAVVKQDIPI--PELEEGFVLIKTVAVAGNPTDWKHIDFKIG---PQG---ALL 63

  Fly    69 GHEGAGIVESVGEGV--TNFKAGDHV----------------IALYIPQCNECKFCKSGKTNLCQ 115
            |.:.||.:..:|..|  ..|..||::                .|.|....:|..:..:.:..||.
Yeast    64 GCDAAGQIVKLGPNVDAARFAIGDYIYGVIHGASVRFPSNGAFAEYSAISSETAYKPAREFRLCG 128

  Fly   116 KIRLTQGAGVMPEGT----SRLSCKGQQLFHFMGTSTFAEYTVVADISLTKINEKAPLEKVCLLG 176
            |.:|.:|.....||.    ..|:..|..|.|..|            :.:|....||..::..|. 
Yeast   129 KDKLPEGPVKSLEGAVSLPVSLTTAGMILTHSFG------------LDMTWKPSKAQRDQPILF- 180

  Fly   177 CGISTGYGAALNTAKVEAGSTCAVW-GLGAVG-LAVGLGCKKAGAGKIYGIDINPDKFE-LAKKF 238
                                    | |..||| :.:.|..|..|..||  |.:...|.| |.|::
Yeast   181 ------------------------WGGATAVGQMLIQLAKKLNGFSKI--IVVASRKHEKLLKEY 219

  Fly   239 GFTDFVNPKDVAD-----KGSIQN--YLIDLTDGGFDYTFECIGNVNTMRSALEATHKGWGTSVV 296
            |..:..:..| ||     |....|  ||:|           |:.|..|::...:........:||
Yeast   220 GADELFDYHD-ADVIEQIKKKYNNIPYLVD-----------CVSNTETIQQVYKCAADDLDATVV 272

  Fly   297 ------------------IGVAG------AGQEISTRPFQLVVGRVWKGSAFGGWRSVSDVPKLV 337
                              :.:.|      .|.::....|.|.....:|.:|....:.::  ||:.
Yeast   273 QLTVLTEKDIKEEDRRQNVSIEGTLLYLIGGNDVPFGTFTLPADPEYKEAAIKFIKFIN--PKIN 335

  Fly   338 EDYLKKDLLVDEFITHELPLSQINEAF--------DLMH---KGESIRSIIK 378
            :..:           |.:|:.......        |:.|   .||.:.:::|
Yeast   336 DGEI-----------HHIPVKVYKNGLDDIPQLLDDIKHGRNSGEKLVAVLK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 92/442 (21%)
alcohol_DH_class_III 9..378 CDD:176260 91/440 (21%)
YNL134CNP_014265.3 enoyl_reductase_like 9..375 CDD:176211 90/438 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.