DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and BDH2

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_009340.1 Gene:BDH2 / 851238 SGDID:S000000057 Length:417 Species:Saccharomyces cerevisiae


Alignment Length:337 Identity:100/337 - (29%)
Similarity:140/337 - (41%) Gaps:73/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKPLVIEDIEVAPPKAHEVRIKITATGVCHTDA---------FTLSGADPE---GLFPVVLGHEG 72
            |:|.:     |||   .|:.|.|...|:|.||.         |...|...|   ...|..:|||.
Yeast    19 KEPHI-----VAP---DELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEM 75

  Fly    73 AGIVESVGEGVTNFKAGDHVIALYIPQCNE--------------CKFCKSGKTNLCQKIRLTQGA 123
            ||.|..||.||.|.|.||.|:......|.:              |..||.|..|:|..:.|. ||
Yeast    76 AGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKGYYNICSYLGLC-GA 139

  Fly   124 GVMPEGTSRLSCKGQQLFHFMGTSTFAEYTVVADISLTKINEKAPLEKVCLLG----CGISTGYG 184
            ||...|                   |||..|:.:....|:.:..||:...|:.    |      .
Yeast   140 GVQSGG-------------------FAERVVMNESHCYKVPDFVPLDVAALIQPLAVC------W 179

  Fly   185 AALNTAKVEAGSTCAVWGLGAVGLAVGLGCKKAGAGKIYGIDINPDKFELAKKFGFTDFVNPKDV 249
            .|:...:.:||||..:.|.|.:||...|....||...|...:....:.|||:|.|...: :|...
Yeast   180 HAIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGARVY-DPTAH 243

  Fly   250 ADKGSIQNYLIDLTDG--GFDYTFECIGNVNTMRSALEA-THKGWGTSVVIGVAGAGQEISTRPF 311
            |.|.|| :||..:.||  ||||||:|.|...|:.:|::. |.:  ||:|.:.:.| ..:|...|.
Yeast   244 AAKESI-DYLRSIADGGDGFDYTFDCSGLEVTLNAAIQCLTFR--GTAVNLAMWG-HHKIQFSPM 304

  Fly   312 QLVV-GRVWKGS 322
            .:.: .|.:.||
Yeast   305 DITLHERKYTGS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 100/337 (30%)
alcohol_DH_class_III 9..378 CDD:176260 100/337 (30%)
BDH2NP_009340.1 butanediol_DH_like 1..375 CDD:176195 100/337 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.