DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and YLR460C

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_013565.3 Gene:YLR460C / 851182 SGDID:S000004452 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:419 Identity:87/419 - (20%)
Similarity:138/419 - (32%) Gaps:149/419 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TCKAAVAWEAKKPLVIEDIEVAPPKAHE--VRIKITATGVCHTD-AFTLSGADPEGLFPVVLGHE 71
            |.||.|. |..|.:|.|.|.:  |:..|  |.||..|.....|| |.......|:|   .:||.:
Yeast     8 TMKAVVI-EDGKAVVKEGIPI--PELEEGFVLIKTLAVAGNPTDWAHIDYKIGPQG---SILGCD 66

  Fly    72 GAGIVESVGEGVT--NFKAGDH--------------------------VIALYIPQCNECKFCKS 108
            .||.:..:|..|.  :|..||:                          |:|...|  ||.||.  
Yeast    67 AAGQIVKLGPAVNPKDFSIGDYIYGFIHGSSVRFPSNGAFAEYSAISTVVAYKSP--NELKFL-- 127

  Fly   109 GKTNLCQKIRLTQGAGVMPEGTSRLSCKGQQLFHFMGTSTFAEYTVVADISLT-------KINEK 166
                         |..|:|.|..|         ...|.:|.......|.:.||       |....
Yeast   128 -------------GEDVLPAGPVR---------SLEGVATIPVSLTTAGLVLTYNLGLDLKWEPS 170

  Fly   167 APLEKVCLLGCGISTGYGAALNTAKVEAGSTCAVWGLGAVGLAVGLGCKKAGAGKIYGIDINPDK 231
            .|..|..:|..|.:|..|.:|                      :.|..|..|..||  |.:...|
Yeast   171 TPQRKGPILLWGGATAVGQSL----------------------IQLANKLNGFTKI--IVVASRK 211

  Fly   232 FE-LAKKFGFTDFVNPKDVADKGSIQNYLIDLTDGGFDYTFECIGNVNTMRSALEATHKGWGTSV 295
            .| |.|::|..:..:..|:.....|::...:::     |..:|:.|.:|::              
Yeast   212 HEKLLKEYGADELFDYHDIDVVEQIKHKYNNIS-----YLVDCVANQDTLQ-------------- 257

  Fly   296 VIGVAGAGQEISTRPFQLVVGRVWKGSAFGGWRSVSDVPKLVEDYLKKD-----LLVD-----EF 350
                                 :|:|.:|.....::.::..|.|:.:||:     :.:|     ..
Yeast   258 ---------------------QVYKCAADKQDATIVELKNLTEENVKKENRRQNVTIDIIRLYSI 301

  Fly   351 ITHELPLSQINEAFDLMHKGESIRSIIKY 379
            ..||:|...|....|    .|:.::.||:
Yeast   302 GGHEVPFGNITLPAD----SEARKAAIKF 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 86/417 (21%)
alcohol_DH_class_III 9..378 CDD:176260 85/416 (20%)
YLR460CNP_013565.3 enoyl_reductase_like 9..375 CDD:176211 86/418 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.