DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and YCR102C

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_010026.1 Gene:YCR102C / 850466 SGDID:S000000699 Length:368 Species:Saccharomyces cerevisiae


Alignment Length:416 Identity:83/416 - (19%)
Similarity:128/416 - (30%) Gaps:156/416 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AVAWEAKKPLVIEDIEVAPPKAHE--VRIKITATGVCHTD-AFTLSGADPEGLFPVVLGHEGAGI 75
            ||..|..|.:|.|.:.:  |:..|  |.||..|.....|| |.......|:|   .:||.:.||.
Yeast     3 AVVIEDGKAVVKEGVPI--PELEEGFVLIKTLAVAGNPTDWAHIDYKVGPQG---SILGCDAAGQ 62

  Fly    76 VESVGEGV--TNFKAGDHVIALYIPQCNECKFCKSGKTNLCQKIRLTQGAGVMPEGTSRLSCKGQ 138
            :..:|..|  .:|..||::..                        ...|:.|             
Yeast    63 IVKLGPAVDPKDFSIGDYIYG------------------------FIHGSSV------------- 90

  Fly   139 QLFHFMGTSTFAEYTVVADISLTKINEKAPLE-----------------------KVCLLGCGIS 180
               .|.....||||:.::    |.:..|:|.|                       .|.|...|:.
Yeast    91 ---RFPSNGAFAEYSAIS----TVVAYKSPNELKFLGEDVLPAGPVRSLEGAATIPVSLTTAGLV 148

  Fly   181 TGYGAALN----TAKVEAGSTCAVWGLGAVGLAVG-----LGCKKAGAGKIYGIDINPDKFE-LA 235
            ..|...||    .:..:......:|| ||.  |||     |..|..|..||  |.:...|.| |.
Yeast   149 LTYNLGLNLKWEPSTPQRNGPILLWG-GAT--AVGQSLIQLANKLNGFTKI--IVVASRKHEKLL 208

  Fly   236 KKFGFTDFVNPKDVADKGSIQNYLIDLTDGGFDYTFECIGNVNTMRSALEATHKGWGTSVV---- 296
            |::|.....:..|:.....|::...:::     |..:|:.|.||::...:........:||    
Yeast   209 KEYGADQLFDYHDIDVVEQIKHKYNNIS-----YLVDCVANQNTLQQVYKCAADKQDATVVELTN 268

  Fly   297 ------------------------IG------------------------VAGAGQEISTRPFQL 313
                                    ||                        |.....:||......
Yeast   269 LTEENVKKENRRQNVTIDRTRLYSIGGHEVPFGGITFPADPEARRAATEFVKFINPKISDGQIHH 333

  Fly   314 VVGRVWKGSAFGGWRSVSDVPKLVED 339
            :..||:|...:       |||:::||
Yeast   334 IPARVYKNGLY-------DVPRILED 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 83/416 (20%)
alcohol_DH_class_III 9..378 CDD:176260 83/416 (20%)
YCR102CNP_010026.1 enoyl_reductase_like 1..367 CDD:176211 83/416 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.