DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and ADH1

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_177837.1 Gene:ADH1 / 844047 AraportID:AT1G77120 Length:379 Species:Arabidopsis thaliana


Alignment Length:376 Identity:188/376 - (50%)
Similarity:257/376 - (68%) Gaps:3/376 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ATEGKVITCKAAVAWEAKKPLVIEDIEVAPPKAHEVRIKITATGVCHTDAFTLSGADPEGLFPVV 67
            :|.|::|.|||||||||.||||||::|||||:.|||||||..|.:||||.:.........|||.:
plant     2 STTGQIIRCKAAVAWEAGKPLVIEEVEVAPPQKHEVRIKILFTSLCHTDVYFWEAKGQTPLFPRI 66

  Fly    68 LGHEGAGIVESVGEGVTNFKAGDHVIALYIPQCNECKFCKSGKTNLCQKIRL-TQGAGVMPEGTS 131
            .|||..|||||||||||:.:.||||:.::..:|.||:.|.|.::|:|..:|: |:..|::.:|.|
plant    67 FGHEAGGIVESVGEGVTDLQPGDHVLPIFTGECGECRHCHSEESNMCDLLRINTERGGMIHDGES 131

  Fly   132 RLSCKGQQLFHFMGTSTFAEYTVVADISLTKINEKAPLEKVCLLGCGISTGYGAALNTAKVEAGS 196
            |.|..|:.::||:|||||:|||||....:.|||..|||:|||::.||:|||.||.||.||.:.|.
plant   132 RFSINGKPIYHFLGTSTFSEYTVVHSGQVAKINPDAPLDKVCIVSCGLSTGLGATLNVAKPKKGQ 196

  Fly   197 TCAVWGLGAVGLAVGLGCKKAGAGKIYGIDINPDKFELAKKFGFTDFVNPKDVADKGSIQNYLID 261
            :.|::|||||||....|.:.|||.:|.|:|.|..:|:.||:||.|:.||||| .|| .||..:.:
plant   197 SVAIFGLGAVGLGAAEGARIAGASRIIGVDFNSKRFDQAKEFGVTECVNPKD-HDK-PIQQVIAE 259

  Fly   262 LTDGGFDYTFECIGNVNTMRSALEATHKGWGTSVVIGVAGAGQEISTRPFQLVVGRVWKGSAFGG 326
            :||||.|.:.||.|:|..|..|.|..|.|||.:|::||........|.|...:..|..||:.||.
plant   260 MTDGGVDRSVECTGSVQAMIQAFECVHDGWGVAVLVGVPSKDDAFKTHPMNFLNERTLKGTFFGN 324

  Fly   327 WRSVSDVPKLVEDYLKKDLLVDEFITHELPLSQINEAFDLMHKGESIRSII 377
            ::..:|:|.:||.|:.|:|.:::||||.:|.|:||:|||.|.||||||.||
plant   325 YKPKTDIPGVVEKYMNKELELEKFITHTVPFSEINKAFDYMLKGESIRCII 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 186/370 (50%)
alcohol_DH_class_III 9..378 CDD:176260 186/370 (50%)
ADH1NP_177837.1 PLN02740 1..375 CDD:178341 186/374 (50%)
alcohol_DH_plants 8..376 CDD:176261 186/370 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3994
eggNOG 1 0.900 - - E1_COG1062
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D664798at2759
OrthoFinder 1 1.000 - - FOG0000360
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100471
Panther 1 1.100 - - O PTHR43880
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.