DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and AT1G32780

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_564409.1 Gene:AT1G32780 / 840172 AraportID:AT1G32780 Length:394 Species:Arabidopsis thaliana


Alignment Length:389 Identity:173/389 - (44%)
Similarity:248/389 - (63%) Gaps:13/389 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSATEGKVITCKAAVAWEAKKPLVIEDIEVAPPKAHEVRIKITATGVCHTDAFTLSGA-DPEGLF 64
            |:.|:||||||||||.|..|.||||::|.|.||:..|||:||..:.:||||....:|. :.|..|
plant     1 MAETQGKVITCKAAVVWGPKVPLVIQEICVDPPQKMEVRVKILYSSICHTDLGCWNGTNEAERAF 65

  Fly    65 PVVLGHEGAGIVESVGEGVTNFKAGDHVIALYIPQCNECKFCKSGKTNLCQKIRLTQGAGVM-PE 128
            |.:||||..||||||||||.:.|.||:||..:..:|.|||.||..::|||::..:.....|| .:
plant    66 PRILGHEAVGIVESVGEGVKDVKEGDYVIPTFNGECGECKVCKREESNLCERYHVDPMKRVMVND 130

  Fly   129 GTSRL---------SCKGQQLFHFMGTSTFAEYTVVADISLTKINEKAPLEKVCLLGCGISTGYG 184
            |.:|.         |.:.|.::||:.||||.||||:....:.||:..:||:::.||.||:|||.|
plant   131 GGTRFSTTINKDGGSSQSQPIYHFLNTSTFTEYTVLDSACVVKIDPNSPLKQMSLLSCGVSTGVG 195

  Fly   185 AALNTAKVEAGSTCAVWGLGAVGLAVGLGCKKAGAGKIYGIDINPDKFELAKKFGFTDFVNPKDV 249
            ||.|.|.|:.|.:.||:|||:|||||..|.:..||.:|.|:|.|..|||..|..|.|||:||||:
plant   196 AAWNIANVKEGKSTAVFGLGSVGLAVAEGARARGASRIIGVDANASKFEKGKLMGVTDFINPKDL 260

  Fly   250 ADKGSIQNYLIDLTDGGFDYTFECIGNVNTMRSALEATHKGWGTSVVIGVAGAGQEISTRPFQLV 314
            ..  .:...:.::|.||.||:|||.|||:.:|.|..:||.|||::|::|:....:.:...|.:|.
plant   261 TK--PVHQMIREITGGGVDYSFECTGNVDVLREAFLSTHVGWGSTVLVGIYPTPRTLPLHPMELF 323

  Fly   315 VGRVWKGSAFGGWRSVSDVPKLVEDYLKKDLLVDEFITHELPLSQINEAFDLMHKGESIRSIIK 378
            .||...||.|||::..|.:|...:..:|..:.::.|||:|||..:||:||.|:..|:|:|.|::
plant   324 DGRRITGSVFGGFKPKSQLPNFAQQCMKGVVKLEPFITNELPFEKINDAFQLLRDGKSLRCILQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 168/381 (44%)
alcohol_DH_class_III 9..378 CDD:176260 168/379 (44%)
AT1G32780NP_564409.1 PLN02740 1..388 CDD:178341 173/389 (44%)
alcohol_DH_plants 9..387 CDD:176261 168/379 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1062
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D664798at2759
OrthoFinder 1 1.000 - - FOG0000360
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43880
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.