DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and AT1G22440

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_173660.1 Gene:AT1G22440 / 838850 AraportID:AT1G22440 Length:386 Species:Arabidopsis thaliana


Alignment Length:383 Identity:180/383 - (46%)
Similarity:244/383 - (63%) Gaps:12/383 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SATEGKVITCKAAVAWEAKKPLVIEDIEVAPPKAHEVRIKITATGVCHTD-AFTLSGADPEGLFP 65
            |.||||.|.||||:..:|.:|||||:|:|.||:|:||||||..|.:|||| .|....:.|...||
plant     5 SITEGKPIRCKAAILRKAGEPLVIEEIQVDPPQAYEVRIKILCTSLCHTDVTFWKLDSGPLARFP 69

  Fly    66 VVLGHEGAGIVESVGEGVTNFKAGDHVIALYIPQCNECKFCKSGKTNLCQK-----IRLTQGAGV 125
            .:||||..|:|||:||.|..||.||.|:.::.|||.|||.|.|.|:|.|.|     :..|:..|:
plant    70 RILGHEAVGVVESIGEKVDGFKQGDVVLPVFHPQCEECKECISPKSNWCTKYTNDYLSNTRRYGM 134

  Fly   126 MPEGTSRL-SCKGQQLFHFMGTSTFAEYTVVADISLTKINEKAPLEKVCLLGCGISTGYGAALNT 189
                |||. ..:|:.:.||:..|:|.|||||....|.||:.:.|::...||.|.::||.|||...
plant   135 ----TSRFKDSRGEDIHHFIFVSSFTEYTVVDIAHLVKISPEIPVDIAALLSCSVATGLGAAWKV 195

  Fly   190 AKVEAGSTCAVWGLGAVGLAVGLGCKKAGAGKIYGIDINPDKFELAKKFGFTDFVNPKDVADKGS 254
            |.||.|||..::|||||||||..|.:..||.||.|:|:||.|||:.|:||.||||||....:| :
plant   196 ADVEEGSTVVIFGLGAVGLAVAEGVRLRGAAKIIGVDLNPAKFEIGKRFGITDFVNPALCGEK-T 259

  Fly   255 IQNYLIDLTDGGFDYTFECIGNVNTMRSALEATHKGWGTSVVIGVAGAGQEISTRPFQLVVGRVW 319
            |...:.::||.|.||:|||||..:.|..|.::|..|.|.::|:|:......||...:.|:.||..
plant   260 ISEVIREMTDVGADYSFECIGLASLMEEAFKSTRPGSGKTIVLGMEQKALPISLGSYDLLRGRTV 324

  Fly   320 KGSAFGGWRSVSDVPKLVEDYLKKDLLVDEFITHELPLSQINEAFDLMHKGESIRSII 377
            .|:.|||.:...|:|.||:.||||:|.:::.|||||...:||:||.|:.:|.|||.||
plant   325 CGTLFGGLKPKLDIPILVDRYLKKELNLEDLITHELSFEEINKAFHLLAEGNSIRCII 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 175/376 (47%)
alcohol_DH_class_III 9..378 CDD:176260 175/376 (47%)
AT1G22440NP_173660.1 PLN02740 4..382 CDD:178341 178/381 (47%)
alcohol_DH_plants 12..383 CDD:176261 175/376 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3994
eggNOG 1 0.900 - - E1_COG1062
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D664798at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43880
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.