DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdh and CG4836

DIOPT Version :9

Sequence 1:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001138085.1 Gene:CG4836 / 42387 FlyBaseID:FBgn0270925 Length:1224 Species:Drosophila melanogaster


Alignment Length:370 Identity:83/370 - (22%)
Similarity:132/370 - (35%) Gaps:94/370 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DIEVAP-----PKAHEVRIKITATGVCHTD--AFTLSGADPEGLFPVVLGHEGAGIVESVGEGVT 84
            :|.|.|     ||..:|.|:..:..|.::|  .:.....|.|.:   .|||:..||||.:|..|.
  Fly   893 EISVVPFSKPRPKDFDVLIRTGSVAVSNSDIHVYENGNRDMEAM---SLGHDATGIVEELGRCVQ 954

  Fly    85 NFKAGDHVIALYIPQCNECKFCKSGKTNLCQKIRLTQGAGVMPEG-TSRLSCKGQQLFHFMGTST 148
            :...||.|:......|..|..||.|..|:|        :|::..| .|........|.|.:..| 
  Fly   955 HLHVGDRVVMESALSCGICDLCKKGLYNMC--------SGLVYNGFLSTYQTHPADLCHRLPES- 1010

  Fly   149 FAEYTVVADISLTKINEKAPLEKVCLLGCGISTGYGAALNTAKVEAGSTCAVWGLGAVGLAVGLG 213
                     ||:    |...|.:...|||       .|...|.|...|...:.|.....:|.|:.
  Fly  1011 ---------ISM----EAGALTQTLALGC-------QACFKANVTPTSNVLILGACPTAVAAGIC 1055

  Fly   214 CKKAGAGKIY-------GIDINPDKFELAKKFGF--TDFVNPKDVADKGSIQNYLIDLTDGGF-- 267
            .|..||.::.       .:|:      :|:.|||  .:|       |..::...:::.....|  
  Fly  1056 AKAIGAKRVAIAGCMAPALDV------VARDFGFQAVEF-------DSNALFGEVLEAIYSKFRD 1107

  Fly   268 --DYTFECIGNVNTMRSALEATHKGWGTSVVIGVAGAGQ-----------EISTRPFQLVVGRVW 319
              |....|..:..||..|:.|...       .||....:           ::..:..:||     
  Fly  1108 WPDCVINCSISAMTMNLAVMALQP-------CGVCVLAECDSECASFNALDVLMKNIRLV----- 1160

  Fly   320 KGSAFGGWRSVSDVPKLVEDYLKKDLLVDEFITHELPLSQINEAF 364
                 ..:||.:..|..::........:.:|||...|||:.:|||
  Fly  1161 -----PSFRSANMYPTALQLMQSGRAHMQKFITATYPLSKADEAF 1200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FdhNP_524310.1 FrmA 9..379 CDD:223990 83/370 (22%)
alcohol_DH_class_III 9..378 CDD:176260 83/370 (22%)
CG4836NP_001138085.1 MDR 888..1218 CDD:302572 83/370 (22%)
Tdh 893..1217 CDD:223991 83/370 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.